KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2930
Entry
Bmul_2930         CDS       T00624                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_2930
Secretion system [BR:bmu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bmul_2930
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABX16614
UniProt: A0A0H3KBG8
Position
1:complement(3206028..3206543)
AA seq 171 aa
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDR
KFVNIDRDNFDDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFNPDEVVEQVEPL
RRLLEARSKLADLRNKLAGNDKLEDLLSEVLKNTQQLQALAKGTGGDKDGE
NT seq 516 nt   +upstreamnt  +downstreamnt
atggccaagaaagagagcattcagaaaagcttgcagaaaatacggccgccgcgcgtccag
ctgacctacgaggtcgagaagggcgatgcgatcgaggtgaaggagctgccgttcgtcgtc
ggggtcgtcgcggatctggccggccagtccgaagtcgagcagccgaagcttcgcgatcgc
aaattcgtcaacatcgatcgcgacaatttcgacgacgtgatgaaggcgatcgagccgcgc
gcggcgttccaggtggaaaaccggctgagccccgagggcggcaagttcgcggtcgacctg
aaattccgttcgctgtcggatttcaatccggacgaagtcgtcgagcaggtcgagccgctg
cgccgcctgctcgaggcgcgctcgaagctcgccgacctgcgcaacaagctcgccggcaac
gacaagctcgaggacctgctgtccgaggtgctgaagaacacgcagcagctgcaggcgctc
gcgaagggcacgggcggcgacaaagacggcgaatga

DBGET integrated database retrieval system