KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3178Help
Entry
Bmul_3178         CDS       T00624                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bmul_3178
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_3178
Secretion system [BR:bmu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bmul_3178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD RHS_repeat RHS Gp5_C
Motif
Other DBs
NCBI-ProteinID: ABX16862
Position
2:23880..29825
Genome map
AA seq 1981 aa AA seqDB search
MVNFKTNRTFSVSGPALPDLEGIGAMLHLSAMRGTEQLSTPYTYELWLTTPADPRLPAEM
LANLDLKAMLGKELTVTIQLDGMGSFVAGMAGQAGAGNLGAGTREISGIVTAASYVDQLN
RQCRYRVVLEPWLALARERTDYRIFQRKSVLDILREVFGSYWYSFEMRVGRTYRTLRYQV
QYGESDFAFAQRLMEEHGIAWFFEHSQGVHRLVLVDGPGAYRSVESVAYQTLEYYPPGRK
IDREHVDRFEATERLQSGVWTTDDFDFEKPGATLTAQNSLPRETAHNQLERYEWPGDYTE
TEDGHAFAQVRMEEIHAQGARAQGEGNLRNVVCGTTFVLAGHPMASANREYLVIASELDV
KETGETTGFSAYAIRSRFTVQPSDVVFRPPRTIRKPRTRGPQTAIVTGPPDAEIWTNKNG
EVTLKFHWDRSDVKDQNSSCWVRVSYPWAGSNFGGIHVPRVGTEVIVDFENGDPDRPIVT
GRVYNAMTMPPWRLPAHATQSGILTRSTKGGGYGNANAIRFEDKKGAEQVWIQAERNLDA
VIEADETHTVGHDRTKRIGHDETDQIGRHWTLSTGGYKFETVTLASVKSVGMGAMFNVGM
AYNVNVGGLYLRNVGLQMASTVGRSRTDRVVQDWTADVGHTYTLTVRGKAVGDAVAADRA
NPIEPSPDFAPQLPAPVSSSNANQLRIADTGESSLSGAKQTQLIGPGGTVTIDESGIHLK
GTAIYLQAPTISMTNGNAGGLAPVTEADCAECAKKSVSANPVDLATGQKVLSHTDFTLPG
RVSIDWSRSYRSADQRRGSLGVAWKLPYATEVRTSATGLIYFDADGRQLQFPALNPGEAH
FHPIEKFTLMRGDDNASGATYALRFGNGVEEHYGRHPVDETRWQLQRIATRDGQCLTLGY
TAQGWLETVRNNVHTVRCALDDAGRITSVLLDQGVGNQPLHLTSYVYDEHGDLVEATDRE
NLTWRYGYDNHLLTTYRTPAGATHVSEWSDDTPNAYCLRTYAYTEGADGQRVVTREMRFD
YLPSLRATRVTDGLGHTTEYHYNGLWAVEKIVHPDGSVEQTHFDETGSVAGYTDALGRTT
RIVNDARGNPTSIIDPAGNVTRISYGEHNLPEQITDPAGQIWQRGYDAHGHLTSETDPLG
NVTRYAYENGLPVARTDALGNVTKMQWDDAGQLVARTDCSGHTTTYDYDPFGQLTETTDA
LGQVSHHSGSVSARVTAVQPAGMGWWKVEYDEAGRAIAHTDPLERVTRVDWDGYGQRTQI
VDPAGGTQQFRYDAIGRLTKLTNANQETTTFRYDSRNRLIEQTGFDGRRQSYRYNAAGEL
VERIDHGQDGQIATHVTYDVLGRPVERRSSDGSQASYRYDERGLLTQAQAIVPGRAPVHV
TYEYDAAGRRTAEVQAHHGRVWRLTHGVDAIGNRDWTHVPDIGSLVWQRYGSGHVHGILL
DEHPLASFERDALHREIRRTQGPASHHFGYGANGLLAVHRWQNLDERGRSLEHPRPWRAW
AYDDAGQLTTLDDAWRDQKAYRYDALSRLTQVMAASGPEAFHYDPAGNLLAAAPSRDNMQ
AWKASGDRLLRFAPQTRPDRPVDFTYDGHGNRIARTVPLPPKPALTEAEKRSQRGTDNLL
RVMEVLTGTPKYEEPSEVPEVTRYRYDGSHQLIAIEHADGARSEYEYDALGRRVAKHHTP
AGGAQQTTLFMWDGDWMMQEVRTGRTSHEDRAVTYVPHPDHEGPLTRLADGQAWHYVTDH
LGTPQELYDEQREVLWAADLSAYGRTARWLTRVVDNPIRFPGQYRDEESGLHYNRFRYYD
PMVGRYINQDPIAFDGGINFYSYADSAPNIAYDPKGLFVPLIAVASFLGRGALGGAVEIA
MQGAKQVFRQAKNNWVDGRPLTDIDWDCVKIDWTDVGVSVAVGGVAPSLGATRKSVTRSI
KAIRNLSNQSANTANRAAKLKVRVDIKKDSIKRDLIVQGAWQGIKQGAKCAFGEEKKCEE
E
NT seq 5946 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatttcaagacgaaccggaccttctcggtcagcggcccggcgctaccggacctc
gaaggcatcggcgcgatgctgcacctgagcgcgatgcggggcacggaacagctttccacg
ccgtacacgtacgaactctggctgacgacgcccgccgatccgcgactgccggccgagatg
ctggccaacctcgatctcaaggcgatgctcggcaaggaactgaccgtcacgatccagctg
gacgggatgggcagctttgtcgcggggatggccggccaggcgggcgcggggaacctgggc
gccggtacgcgagaaatcagcggcatcgtgacggcggccagctacgtggatcaactgaat
cgccagtgccgttatcgcgtcgtactggagccctggctggcactggcgcgcgagcggacc
gactatcgcatcttccaaaggaagagcgtgctcgacattctgcgcgaggtgttcggttcg
tattggtattcgttcgagatgcgcgtcggccgcacctacagaacgctgcgctatcaggtc
cagtacggcgaatcggacttcgcgtttgcccagcgcttgatggaggaacacggcatcgcg
tggttcttcgaacactcgcaaggcgtacaccgcctggtgctggtcgacggtccgggcgcc
tatcggagcgtggaaagtgtcgcgtatcagacgctcgagtactacccgccgggccggaag
atcgaccgcgagcacgtcgatcgcttcgaggcgacggagcgtctgcaatcgggcgtctgg
accaccgacgatttcgatttcgagaagccgggtgcgacgctgaccgcgcagaacagcttg
ccgcgcgagacggcgcacaaccagctcgaacgttacgaatggcccggcgactatacggaa
acggaggacggccacgcattcgcacaagtgcgcatggaggagattcacgcgcagggcgca
cgcgcgcaaggcgagggcaacctgcgcaacgtggtgtgcggcacgacgttcgtgctggcc
ggccatccgatggcgagcgccaaccgcgagtatctggtgatcgcgtcggagctggacgtg
aaggaaaccggcgagacgaccggcttctccgcctacgcgattcgcagcaggttcaccgta
cagccgtccgacgttgtattccgtccgccgcgcacgatcaggaaaccgcgtacgcgcggc
ccgcagacggcgatcgtgacgggcccgccggacgcggagatctggacgaacaagaacggc
gaggtgacgctcaagttccattgggaccgatccgacgtgaaggatcagaactcgtcctgc
tgggtgcgcgtgtcctatccgtgggccggcagcaacttcggcggcattcatgttccgcgg
gtcggcaccgaagtcatcgtcgatttcgaaaacggcgatccggatcgaccgatcgtgacg
gggcgcgtctacaacgcgatgacgatgccgccgtggaggctgccggctcacgcgacgcaa
agcgggatcctcacgcgctcgaccaagggcggcggatacggcaacgccaatgcgatccgc
ttcgaggacaagaaaggagcggagcaggtctggatccaggccgagcgcaatctcgatgcg
gtgatcgaggccgacgaaacgcacacggtcgggcatgaccgcacgaagcggatcggccac
gatgaaaccgaccagatcgggcgacactggacgctgtcgaccggcggctacaagttcgag
accgtgacgctggcgtcggtgaagagcgtgggcatgggcgcgatgttcaacgtcgggatg
gcctacaacgtcaacgtcggcgggctgtacctgcgcaacgtcgggctgcagatggccagc
acggtgggccgcagtcgcaccgaccgcgtcgtgcaggactggacggccgatgttgggcac
acctatacgctgaccgtgcgcggcaaggcggtgggcgatgccgtggccgccgatcgggcg
aatccgatcgagccgtcgcccgacttcgcgccgcagctgcccgcaccggtatcgagctcg
aacgccaaccagctgcgcatcgcggatacgggcgagagcagcctgtcgggcgcgaaacag
acgcaactgatcgggccgggcggcacggtgacgatcgacgagtccggcattcatctgaaa
ggcacggcgatttacctgcaggcgccgacgatcagcatgacgaacggcaatgccggtggc
ctcgcgccggtgaccgaagccgactgcgcggaatgcgcgaagaagagcgtcagtgcgaac
ccggtcgatctggcgacggggcagaaggtgctgtcgcatacggactttacgttgcccggc
cgcgtatcgatcgactggagccggagctaccgtagcgcggatcagcgccgcggcagtctg
ggcgttgcatggaagctgccgtatgcaacggaagtgcgcacgagcgcgacaggcttgatc
tacttcgacgccgacgggcggcagttgcagtttccggccttgaacccaggcgaagcgcat
ttccatccgatcgagaagttcacgctgatgcgcggtgacgacaacgcgtcgggcgccacc
tatgcgctgcgtttcggcaatggcgtcgaagagcattacggccgtcacccggtcgacgag
acgcgctggcaattgcaacgcatcgcgacgcgcgacggccagtgcctgacgctcggctat
acggcacagggctggttggaaacagttcgcaacaatgtgcataccgtgcgctgcgcgctc
gacgatgccggccggatcacgagcgtgttgctcgaccagggtgtcggcaatcagccgctg
cacctgacgagctacgtgtacgacgagcacggcgatctggtcgaggccaccgatcgcgag
aacctgacgtggcgctacggctacgacaaccatctgctgacgacctaccgcacgccggcc
ggcgcgacgcacgtatcggagtggagcgacgacacgccgaatgcgtactgcctgcggacc
tacgcctataccgaaggcgccgacgggcagcgagtcgtcacacgcgagatgcgtttcgat
tacctgccgtcgctgcgcgcgacgcgggtgacggacggcctcgggcatacgaccgaatat
cactacaacggcctgtgggcggtcgagaagatcgtgcatcccgacggcagtgtcgagcag
acgcatttcgacgagacggggagcgtggccggctacacggatgcactcggtcgcacgacg
cggatcgtgaacgatgcgcgcggcaatccgacgtcgatcatcgacccggccggcaacgtc
acgcgcatcagctatggcgagcacaacctcccggaacagattaccgacccggccgggcag
atctggcagcgcggctacgatgcgcacggtcacctgacgagcgaaaccgatccgctcggc
aacgtgacgcgttacgcctacgaaaacggcttgcccgtcgcgcgcacggatgcactgggg
aacgtgacgaagatgcaatgggacgacgcgggtcagctcgtggcgcgcaccgattgctcc
ggacacacgacgacctatgactacgatccgttcggccagttgaccgagaccaccgacgcg
ctcggtcaggtgagccaccacagcggcagcgtgtctgcgcgcgtgacggcggtgcagccg
gccggcatgggctggtggaaggtcgaatacgacgaagcgggtcgcgcgatcgcgcatacg
gatccgctcgagcgcgtgacgcgcgtggactgggacggttacgggcagcgaacgcagatc
gtcgatccggcgggcgggacgcaacagttccgatatgacgcgatcggccgtttgacgaag
ctcaccaatgcgaaccaagagacgactacgttccgctacgacagccgcaaccgcttgatc
gaacagaccggcttcgacggccgtcggcagagctaccggtacaacgcggcgggcgaactg
gtcgagcgcatcgatcacggccaggacggacagatcgcgacgcacgtgacctacgacgtg
cttggccgcccggtggagcgacgctcgagcgatgggagccaagcgagctatcgctacgac
gagcgcgggctgctgacgcaggcgcaggcgatcgtgcccgggcgtgcgccggtgcacgtc
acttacgaatacgacgcagccgggcgccgcacggcggaggtgcaggcgcatcacgggcgg
gtctggcggctcacgcacggcgtggacgcgatcgggaatcgcgactggacgcacgtgccg
gacatcggttcgctggtctggcagcgctacggctcggggcatgtgcacggcatcctgctc
gacgagcatccgctggcgagtttcgagcgcgacgcgctgcatcgggaaatccggcgtacg
caaggtccggcgtcgcatcacttcgggtatggcgcgaatggcctgctggcggtgcatcgc
tggcagaacctcgatgaacgggggcgctcgctggagcatccgcggccgtggcgggcgtgg
gcatacgacgacgccggtcagctgacgacgctggacgatgcgtggcgcgatcagaaggcg
tatcggtacgacgcgctatcgcggctgacgcaggtgatggcggcgagcggaccggaagcg
tttcattacgatccggcgggaaacctgctggctgctgcgccgagccgggacaacatgcag
gcgtggaaggcgagcggcgatcgcttgctgcggtttgcgccgcagacgcgcccggatcgt
ccggtggattttacgtacgacgggcatggcaatcgcattgcgcggacggtgccgttgccg
ccgaagccggcgctgacggaagcggagaagcgcagccagcgcgggacggacaacctgctg
cgcgtgatggaagtgctgacggggacgccgaagtacgaggagccgtcggaagtgccggag
gtgacgcggtatcggtacgacggcagccaccagttgatcgcgatcgaacatgcggacggg
gcgagaagcgagtacgaatacgacgcgctcggtcggcgggtggcgaagcatcacacgccg
gcgggcggcgcgcagcagacgacgctgttcatgtgggacggcgactggatgatgcaggag
gtgcgcacggggcgcacgtcgcatgaggacagggcggtgacctatgtgccgcatccggat
catgaaggaccgttgacgcggctggcggatgggcaggcgtggcactacgtgacggatcac
ctggggacgccgcaggaactgtacgacgaacagcgcgaggtgttgtgggcggcagatttg
agcgcgtatggacgtacggcgaggtggttgacgcgtgttgttgacaatccgatacgtttt
ccggggcagtaccgggatgaggagtcagggctgcattacaaccggttcaggtactacgat
ccgatggtggggcggtatatcaatcaggatccgatcgcctttgatggtggaatcaatttt
tacagctatgcagatagtgcgcctaacattgcttacgatccgaaaggcctatttgttcca
ttgatcgctgttgcttcatttttggggagaggggcgcttggtggggcggtcgaaattgct
atgcaaggggcaaagcaagtattcaggcaagcaaaaaataattgggttgatgggcgtccg
ctaaccgatattgattgggattgcgtaaaaatcgactggacagatgtgggggtttcagtc
gccgtcggaggcgtggcgcctagtttgggggcgactagaaaaagcgtaactagatccata
aaagccattagaaatctatctaatcaatccgctaacacggcaaatcgcgcggcaaaattg
aaggtgcgcgttgacattaaaaaggattcaatcaaacgcgatttgatcgtgcagggggca
tggcaaggaattaagcagggtgcaaagtgtgcttttggtgaggagaaaaaatgcgaggaa
gagtag

DBGET integrated database retrieval system