KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3182Help
Entry
Bmul_3182         CDS       T00624                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bmul_3182
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_3182
Secretion system [BR:bmu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bmul_3182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C
Motif
Other DBs
NCBI-ProteinID: ABX16866
UniProt: A0A0H3KQ33
Position
2:35515..39468
Genome map
AA seq 1317 aa AA seqDB search
MKKILSFPSWRHLWAVVMVIAAVVVIWFAGPLLTFGGLSPLASIGIRLTLIALVLAAWAL
WLIDWTMSIVIVVLLCLAIWHAFPLVTLSGKPLFASVTARILAMIGVVFVYAGVMSVRWW
RQMRRHPGRLRRWLRLGKRGPRPLAASRLAEIEDMARATIAQLKAGRAVHGRLARLFRGA
AHLYDVPWYVVLGPKGSGKTSMLLNSGLAFPLDARLQHSLAPDDARALPGWRLTNEAVLI
DTAGHYVQHGTSRYSLPVASSDGPNGGKRKKQPPDMAAVRRQSDSAEWHGFLRLLRRIRP
RLPLNGVLLTIDVAALAHADPAAHTTESRALRARLEEMQAEFGTGFPVWLVVTKMDRLPG
FTDYFAALGQAERAQILGVTLGSGQQARMNDAIRTELNLLATRLADGVTSLLRNEADMDR
RRRLAVLPESVAALVNPLADLIEHVFARDDNGGPTQPRAMFRGVYLTSAIQGDHAIAAER
RTLLRRMIDASGTTRRAPRPARGETGYFLRDLWLAVVFREGHLASPNWNREHRVRLQRWL
GHSLVWLIAAAMCVNLWNGFVTERTSLATLGQNARSLAALLARNDLSADPERVPMVLNRA
KELLHDATRLATDADGTFRFATARLETIASDSRHAYEALSDQAVLPHIVRRMEGAISSAV
AIGDAQAAYDALRVYLMLHDRERFNANDVRMWVLDDWWRHDSAATFGGRAAMMGHVERLF
SEGHVVRSPLSRNDALIRQARVFLDGSDLIERLYRRAKATMWKDAPDDFSLLRMVGTQAG
MVFTCVSGAPLSGGVPGIFTREGYQAVFSKRLPEFLRAASDDDAWVMGRRASGDPRRHSA
GTLNAPNQDDDALLAAITRRYLLEYAQQWDAFLGDIRIVSGTSLAFNLKILRTLAAPDSP
LTRLARAAVIETTLTQPMAKSDGALLAKATDAIHQKAETVLGPRASEQLEREWVDRHFAA
LREVVTGHADTRSDTQPVETSAGRTGLDGIADLLNDYYAALAIADNALLNNSMPPASEHA
AKLKMMADTMPAPLRAVLHQLAVEGSRGVNQGIGRLLSRQVQAAIGDVCRTTIEGNYPFS
PDSSRDVGIDDFTRMFAHGGVIDDFFTRTLAPFVDTAAKPWRYRTLPGATEAVQGPDLAP
FEHAKAIRDIFFNEVDRTRPSWKVDIRIPELDPTIMSLSLDIDGQTTRYRHGPVEPFTVT
WPGPRGGAHAWLVASPSIGPNTWTIAADGPWALMRLLRKGHVIETATLGRTRVVFSFDGR
EAALDIASAGSAGNPLTSDVLATFRCPGTMAMFNLPDSGPPPGLPHGRLPAMPDSGL
NT seq 3954 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattctctcgtttccaagttggcgtcatctgtgggcggtcgtgatggtgatc
gctgccgtcgtcgtgatctggtttgcaggaccgttgctgactttcggcggactgagcccg
ctcgcctcgatcggcattcgactgacgttgatcgctttggtactcgccgcatgggccttg
tggctgatcgactggacgatgagcatcgtgatcgtcgtgctgctctgtctcgcgatctgg
catgcgtttccgctcgtgacgctgtctggcaaaccgctgtttgcttccgtaacggcccgc
attctggcaatgatcggtgtggtgttcgtttatgccggcgtcatgtcggtccgatggtgg
aggcaaatgcgccggcaccccggtcggctcagacgatggcttcgactcggcaaacgtggc
ccacggccgctggccgcatcgcgcttggcagaaatcgaggacatggcgcgcgcaacgatc
gcgcagttgaaagccgggcgagcggtccacgggaggctggcgcgactgtttcgaggcgca
gcacatctctacgatgtgccttggtacgtcgtgctgggtccgaagggttcgggcaagacc
tcgatgctgctcaactccggcttggcgtttccgctcgatgctcgacttcagcattcgctt
gcacccgatgacgcacgggccttgccgggatggcggctgaccaatgaggcggtgctgatc
gatacggcgggtcactacgtacaacacggcacgtcgcgctactcgctgccggtggcgtcg
tcggacgggccgaacggcggcaagcggaaaaaacagccacccgacatggccgccgttcgc
aggcagtccgattccgcggagtggcacgggtttcttcggctgcttcgccgtatccggcct
cgcttgccgctgaatggcgtgctgttgacgatcgacgtcgctgcgttggcgcatgcggat
cctgccgcacatacgaccgagagccgcgcgttgcgggctcgcctcgaggagatgcaagcc
gaattcggcaccgggtttcccgtctggctggtcgtcacgaaaatggatcggctcccgggg
ttcaccgactatttcgcggcgctcgggcaagcggagcgtgcgcagattttgggtgtgacg
ctcgggtccggccagcaggcgcggatgaacgatgcgatccggacagaactgaatctgctt
gccacgcgtctcgccgatggcgtcacgagcctgcttcgcaacgaagccgatatggaccgc
cggcgccgtcttgcggtgttgcccgaatcggttgcggcactggtgaacccgttggccgac
ctgatcgaacacgtgttcgccagggacgacaacggcgggccgacgcaaccgcgtgcgatg
ttccgaggcgtttatctgacgagcgcaatccagggtgatcacgcgatcgctgcggaacgt
cgaacgctattgcgacgcatgatcgacgcatccggcacaacacggagggccccgcggccg
gcgcgtggcgaaaccggttacttcctgcgcgatttgtggctcgcggtcgtgtttcgtgaa
gggcatctcgcgagccctaactggaatcgcgagcatcgggtacgactgcagcggtggctg
ggacactcgctcgtgtggctgattgcggccgcaatgtgcgtcaatctttggaatggcttc
gtcacggaacgaacatcgcttgcgacgctcgggcaaaatgcacggtcactcgccgcatta
ctcgcacgaaacgacctttccgccgatcccgagcgtgtgccgatggtgttgaaccgtgcg
aaggaattgctgcatgacgcgacgcgtctcgccaccgatgccgacggcacgtttcgtttt
gcgacggcccgcctcgagacgatcgcgtccgacagccgccatgcgtacgaggccctgtcg
gaccaggccgtgttgccgcacatcgtccgccgcatggagggcgcaatcagcagtgctgtg
gcgatcggcgacgcccaagccgcttacgacgcgttgcgcgtgtacctgatgctccacgac
cgagagcgtttcaacgcgaacgacgtcaggatgtgggtgctcgacgattggtggaggcac
gacagcgcggccacgttcggtgggcgtgccgcaatgatgggccacgtcgaacggctgttt
tcggaaggacatgtcgtgcgctcgccactgtcgcgtaacgatgccttgatccggcaggca
cgtgtctttctcgacggcagcgacttgattgaacgtctttaccggcgcgccaaagcgacg
atgtggaaggacgcgccggacgatttttcgctgctgcggatggttggaacgcaggccggc
atggtgtttacgtgcgtcagcggcgcgcccttgtccggcggcgtgccgggaatctttacg
cgagaaggctatcaggcggtgttcagcaaacgcttgccggaattccttcgcgcggccagc
gacgacgacgcctgggtaatgggacgtcgagcatcgggcgatcctcgcaggcattccgct
ggcacgttgaacgccccgaaccaggacgacgacgcgctgctggcagcgattacgcgccgg
tacctgctcgagtacgcgcaacaatgggatgcgtttcttggcgacatccgtatcgtgagc
ggaacgagtctcgcgttcaacctcaagatactgcgaacgctcgccgcgccggattcaccg
ctgacgcgtctggcccgggcggcggtaatcgaaacgacgctgacacagcccatggcgaag
tcggacggcgccttgctcgcaaaagcaaccgacgcgatccaccagaaagccgagacagta
ctggggcctcgtgcatcggaacagcttgaacgcgagtgggtcgatcgtcatttcgcggca
ttgcgcgaagtcgtgacgggccatgccgatacacgctcggatacgcagccggtggagacg
tccgcgggaagaacgggcctggacggaatcgccgatctgttgaacgactactacgcagcg
ctcgcaattgccgacaacgcgctgctgaacaacagcatgccgccggcaagcgagcacgcc
gcgaagctgaagatgatggccgatacgatgcccgcgccgttgcgggcagtgctgcatcaa
ctcgccgtcgagggctcgcgcggagtcaatcagggtatcggccggctgctgtcgcgccag
gtgcaggcggcaatcggggacgtttgtcgaacgacgatcgaaggcaactacccgttctcg
cccgatagcagccgcgacgtcggtatcgacgatttcacgcggatgtttgcgcacgggggc
gtgatcgacgacttcttcacgagaacgcttgctccgttcgtcgataccgcggcgaaaccg
tggcgctaccggacgctgccgggcgcgaccgaagccgtccaagggcccgacctcgcgcca
ttcgagcatgccaaggcaatccgcgacattttcttcaacgaggttgatcgcacgcgaccg
agctggaaggtcgacatccgcatccctgaactcgatccgacgatcatgagcctgtcgctc
gacatcgacggacagacgacgcgttatcgacatggcccggtcgagccttttacggtgacc
tggccgggaccgcgcggtggcgcacacgcatggctcgtcgcgagcccgagcatcgggccg
aacacgtggacgatcgcagcggacggaccgtgggcgctcatgcgtttgcttcggaagggg
cacgtaatcgagacggccacgttgggccgcacgcgcgtggtgttcagcttcgacggtcgc
gaagcggcgctcgacatcgcgagcgcgggaagtgccgggaatccgttgacgagcgatgtg
ctcgcgacgttccgctgtccgggcacgatggcgatgttcaacctgccggatagcggcccg
ccgccgggattgccgcacggcagattgccggcaatgcctgacagcgggctttga

DBGET integrated database retrieval system