KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3298Help
Entry
Bmul_3298         CDS       T00624                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-ProteinID: ABX16982
Position
2:179758..180315
Genome map
AA seq 185 aa AA seqDB search
MPLPCAAPARCARYTGSSIPHTDERAMLQMRPMTAGEFRAYRARAIEGYARDLVASGQNT
TEDAAPRAQRCFDTLLPDGLSTPGQTLVSLVDSTSGETVGDLWYAIVTEGPHRTLFIYDL
DIVPSRRRQRWATRVLDALEAEARRYGVTEIGLSVFNHNVAARALYRACGFVPITTTLIK
PVVSS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgccgtgcgctgcgccggcgcgatgcgcccgctacactgggagttcgattcct
cacacggacgaacgcgcgatgctgcagatgcggccgatgacggccggcgaattccgcgcc
taccgcgcgcgtgcgatcgaaggctacgcgcgcgatctcgttgcctccggccagaacacg
accgaagacgccgcgccgcgtgcgcagcgctgcttcgatacgttgctgccggacggcctg
tcgacccccggccagacgctcgtttcgctcgtcgattcgacgagcggcgagacggtcggc
gacctctggtatgcgatcgtgaccgaagggccgcatcgcacgctgttcatctacgacctc
gatatcgtgccgtcgcggcgccgccagcgctgggcgacgcgcgtgctcgacgcgctcgag
gccgaggcgcgccgctacggcgtgaccgaaatcgggctctcggtgttcaatcacaacgtc
gcggcgcgcgcgctttatcgcgcgtgcggcttcgtgccgatcacgacgacgctgatcaag
cccgtcgtatcgagctag

DBGET integrated database retrieval system