KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3299Help
Entry
Bmul_3299         CDS       T00624                                 

Definition
(GenBank) heavy metal translocating P-type ATPase
  KO
K17686  Cu+-exporting ATPase [EC:3.6.3.54]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     Bmul_3299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMA E1-E2_ATPase Hydrolase TusA HAD Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: ABX16983
Position
2:complement(180409..183957)
Genome map
AA seq 1182 aa AA seqDB search
MTESLASASLHTIELGVDGMHCGGCTGRVQRALAGVPGVVDATVDLERQAATITARETVE
PARLVDAVGAAGYRATVREAVAGSDAMAAQGKHEGSPGAAATVLLDIDGMTCASCVSRVE
KALVKVPGVTRASVNLATERATVEASADVSAAQLVEAVEQAGYGATPIESAPAVVTSAPV
DHKAAHSVELDIDGMTCASCVSRVEKALAKVPGVAHASVNLATERATVEASADVSAARLV
EAVEQAGYRATSVESAPPAATSAPVDHKAAHSVELDIDGMTCASCVSRVEKALEKVPGVT
HASVNLATERATVEASADVSAARLVEEVEQAGYGATPIEPARAAVTSEPADHKAARSIDL
DIDGMTCASCVSRVEKALAKVPGVTHASVNLATERATVEASADVSAAQLVEAVEQAGYQA
MPVESAPSPARSASAEREATHSIDLDIGGMTCASCVSRVEKALEKVPGVTHASVNLATER
ASVRAAGPLDVDALIAAVTTAGYRATLTPAPAADANAAASSTRAAPDRDARKRQEALRER
NLVIASAVLSAPLVAPMLAAPLGIDAMLPGWLQLVLASIVQFGFGARFYRAAWHAVKARA
GNMDLLVALGTSAAYGLSLWMLLRDPAHPGHLYFEASAVIVTLVRFGKWLEARAKRQTTD
AIRALNALRPDRARIVENGVERDVPLAQVRVGTIVSVRPGERLPVDGRVVSGRSHVDESL
ITGESLPVPKDDGDAVTAGSINGEGALVVETTAIGAETTLARIIRLVESAQAEKAPIQRL
VDRVSAVFVPAILGIAVLTLVGWLLAGAGAETAILNAVAVLVIACPCALGLATPAAIMAG
TGVAARHGVLIKDAQALELAQRATVIAFDKTGTLTEGKPSVTAFDAVDLPRDDALALAAA
VQRHSDHPLARAVVAAYDAQRNAQAAPVATDARAVAGRGVEARVDGRLLALGSTRWRDEL
GIVVPPALDARAAELERAGNTISWLMHADAPRAAIALIAFGDTVKPGARDAIAALAARHV
ASVLVTGDNRGSAAAVAAALGIDEVHAQVLPDDKARVVASLKREHGGVVAMVGDGINDAP
ALAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAIDISKRTYRKIQQNLFWAFVYNL
IGVPLAALGWLNPVIAGAAMAFSSVSVVTNALLLRRWKGRAR
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatcactcgcatccgcgtcgctgcatacgatcgaactgggtgtcgacggcatg
cactgcggcggctgcaccggacgcgtacagcgagcgctggccggcgtgccgggcgtcgtc
gacgcgacggtcgacctggagcggcaggcggcaacgattaccgctcgcgagacggtggag
ccggcgcggctcgtcgatgccgtcggcgccgcgggttatcgcgcgaccgtgcgcgaggcc
gtggcgggaagcgatgcgatggccgcgcaggggaagcacgaggggtcgcctggggcggcg
gcgacggtcttgctcgacattgacgggatgacgtgtgcgtcctgtgtatcgcgtgtcgaa
aaggcactggtgaaggtgccgggcgtcacgcgggcgtcggtcaacctcgcgaccgagcgc
gccaccgttgaagcgtccgccgacgtttccgccgcgcagctcgtcgaagcggtcgaacag
gcgggctatggggcgacgcctatcgaatcggctccggcggtcgtgacgtccgcaccggtc
gaccataaagctgcgcacagcgtcgaactcgacattgacgggatgacctgcgcgtcctgt
gtatcgcgtgtcgaaaaggcgttggcgaaggtgccgggcgtcgcgcacgcgtcggtcaat
ctcgcgacggaacgcgccaccgttgaagcgtccgccgacgtttccgccgcgcgactcgtc
gaagcggtcgagcaggcgggctatcgtgcgacgtccgtcgaatcggctccaccggccgca
acgtccgcaccggtcgaccataaagctgcacacagcgtcgaactcgacattgacgggatg
acctgcgcgtcctgcgtatcgcgtgttgaaaaggcgttggagaaagtgccgggcgtcacg
cacgcgtcggtcaatctcgcaaccgaacgcgcgaccgttgaagcgtccgccgacgtttcc
gccgcgcggctcgtcgaagaggtcgagcaggcgggctatggagcgacgcctatcgagccg
gctcgggcggccgtgacgtccgaaccggccgaccataaagctgcgcgtagtatcgacctc
gacattgatggaatgacctgcgcctcatgcgtatcacgtgtcgagaaggcgttggcaaag
gtgccaggcgtcacgcacgcgtcggtcaacctcgcaaccgagcgcgccaccgttgaagcg
tccgccgacgtttccgccgcgcagctcgtcgaagcggtcgaacaggcgggctatcaggcg
atgccggtcgaatcggctccatcgcccgcacgctcggcttccgcggagcgcgaagccacg
cacagcatcgacctcgacatcggcggaatgacctgcgcgtcctgcgtatcgcgcgtcgaa
aaggcgctggagaaagtgccgggcgtcacgcacgcgtcggtcaatctcgcgaccgaacgc
gcgtcggtccgggccgccggcccgctcgacgtcgacgcgctgatcgcggccgtcacgacc
gccggctaccgcgcgacgctcacgccagcacccgcagccgacgcgaacgccgccgcttca
tccacccgcgccgcacccgaccgcgacgcgcgcaagcgtcaggaagcgctgcgcgagcgc
aatctcgtgatcgcgtcagccgtgctgagcgcgccgctcgtcgcgccgatgctcgccgcg
ccgctcggcatcgacgcgatgctgccaggctggctgcagctcgtcctcgcatcgatcgtc
cagttcggcttcggcgcgcgcttctaccgcgccgcatggcatgcggtgaaggcgcgcgcc
ggcaacatggacctgctggtcgcgctcggcacgtcggctgcgtacgggctgagcctgtgg
atgctgctgcgcgatcccgcgcatccgggccatctgtatttcgaggcgtccgccgtcatc
gtcacgctcgtgcgtttcggcaagtggctcgaagcgcgcgcgaagcgtcagacgaccgat
gcgatccgcgcgctcaacgcgctgcggcccgaccgcgcgcgcatcgtcgagaacggcgtc
gagcgcgacgtgccgctcgcgcaggtgcgcgtcggcacgatcgtcagcgtgcggccgggc
gagcgcctgccggtcgacgggcgcgtcgtctcgggccgctcgcatgtcgacgagtcgctg
atcacgggcgaaagcctgcccgtcccgaaggacgacggcgacgccgtcacggccggctcg
atcaacggcgaaggcgcgctcgtcgtcgagacgaccgcgatcggcgccgaaacgacgctc
gcgcgcatcatccgcctcgtcgaatccgcgcaggcggaaaaggcgccgatccagcgcctc
gtcgatcgtgtcagtgccgtattcgtgccggcgatcctcggcatcgcggtgctgacgctc
gtcggctggctgctcgccggcgccggcgcggaaaccgcgatcctcaacgccgttgccgtg
ctcgtcatcgcgtgcccgtgcgcgctcggcctcgcgacgcccgccgcgatcatggccggc
accggtgtcgccgcgcggcacggcgtgctgatcaaggacgcgcaggcgctcgaactcgcg
cagcgcgcgaccgtgatcgcattcgacaagactggcacgctgaccgaaggcaagccgtcc
gtcacggcgttcgacgcggtcgacctgccgcgcgacgacgcgcttgcgctcgcggcggcc
gtgcagcggcacagcgaccatccgctcgcgcgcgcggtcgtcgccgcgtatgacgcgcag
cgcaacgcgcaggccgcgcccgtcgcgacggacgcacgcgcggtggctggacgcggcgtc
gaagcgcgtgtcgacggccgattgctcgcgctcggcagcacgcgctggcgcgacgagctc
ggcatcgtcgtgccgcccgcgctcgacgcgcgcgcggccgagctcgagcgcgcgggcaac
acgatttcgtggctgatgcacgccgacgcgccgcgcgcggcgatcgcgctgatcgcgttc
ggcgataccgtgaagcccggcgcgcgcgacgcgatcgccgcgctcgccgcccggcacgtc
gcgagcgtgctcgtcaccggcgacaaccgcggcagcgcggcggccgtggccgcggcgctc
ggcatcgatgaagtgcatgcgcaggtgctaccggacgacaaggcgcgcgtcgtcgcgtcg
ctcaagcgcgagcacggcggcgtggtcgcgatggtcggcgacggaatcaacgatgcgccc
gcgctggccgcagcggacgtcgggatcgcgatggcgaccggcaccgacgtcgcgatgcat
acggccggcatcacgctaatgcgcggcgacccggcgctcgtcgccgacgcgatcgacatc
tcgaaacggacgtaccggaagattcagcagaacctgttctgggccttcgtgtacaacctg
atcggcgtgccgctcgcggcgctcggctggctgaatcccgtgattgcgggcgcggcgatg
gcgttctcgagcgtcagcgtcgtgacgaacgcgttgctgctgaggagatggaaaggacgc
gcgcgatga

DBGET integrated database retrieval system