KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3300Help
Entry
Bmul_3300         CDS       T00624                                 

Definition
(GenBank) protein of unknown function DUF1214
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1254 DUF1214
Motif
Other DBs
NCBI-ProteinID: ABX16984
UniProt: A0A0H3KTW1
Position
2:184364..185791
Genome map
AA seq 475 aa AA seqDB search
MIEHLRESLSLRRACASLAMAALLAGCASQPDAIQRKTGWMRTEVADSYVYAYPLVLMDV
AKDAATGGDGAQPGQAPLNTLRHAQALPPVGAVNPPLPGVDTLDSTGWLDVAAEPVIVTL
PDTRGRYWDARALDMWTNVLWSASSAAVRGSRRSQTIAFVAKDWQGTLPKGTVRVDVPTR
HAWLEVRLQTSGGRDLTAVKKLQRAMRIVPLSVYTGDTRGASVAVHTGSAPADALTGGTP
AEQVAALDPKAFFTRFARALQDNPAPDDDPHAQQLLDDIGVSAGNPVQWTGDRLTAATAG
VAEGRARLAAPPPNLLSANGWSWIGDTAGKYGQDYALRAYAAYTQFGTATRDDETIAIVR
VDSDGQPLNGANRYVLHFAPGALPPVRGFWTLTPYTPGGALPDVGAARRSLGDRDRLRRN
HDGSVDIVVSAAPGAARAANWLPAPRADFALALRLYAPKPQATDGSWMPPAVVRK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacaccttcgagaatccctttctctgcggcgcgcgtgcgcgtcgctcgccatg
gcggcgctgctcgcgggatgcgcgtcgcagccggacgcgatccagcgcaagacgggctgg
atgcggacggaagtcgccgattcctatgtctatgcgtatccgctcgtgctgatggacgtc
gcgaaagatgcggcgacaggcggcgacggcgcgcaacccggccaggcgccgctgaacacg
ctgcgtcacgcgcaggcgctgccgccggtcggcgcggtgaatccgccgctgccgggcgtc
gatacgctcgactcgaccggctggctcgacgtcgcggccgagcccgtgatcgtcacgctg
cccgacacgcgcggccggtactgggacgcgcgcgcgctcgacatgtggaccaacgtgctg
tggtcggcgtcgagcgcggcggtgcgcggcagccgccgatcgcaaacgattgccttcgtc
gcgaaggactggcagggcacgctgccgaagggcacggtgcgcgtcgacgtgccgacgcgc
catgcgtggctcgaggtacgactgcagacgagcggcggacgcgacctcacggccgtgaag
aaactgcagcgcgcgatgcgcatcgtgccgctgtcggtctacacgggcgacacgcgcggc
gcctcggtcgccgtccatacgggcagtgccccggccgacgcgctgacgggcggcacgccg
gccgaacaggtcgccgcgctcgatccgaaggcgttcttcacgcgctttgcacgcgcgctg
caggacaatcccgcgccggacgacgatccgcacgcgcagcagctgctcgacgacatcggc
gtatcggccggcaacccggtgcagtggacgggcgataggctgacggccgcgacggccggc
gtcgccgaagggcgcgcgcggctcgcggcgccgccgccgaacctgctgagcgcgaacggc
tggagctggatcggcgatacggccggcaagtacgggcaggactatgcgctgcgcgcgtac
gcggcctatacgcagttcggcaccgcgacgcgcgacgacgagacgatcgcgatcgtccgc
gtcgacagcgacggccagccgctgaacggcgcgaaccgctacgtgctgcatttcgcgccg
ggtgcattgccgccggtgcgcggcttctggacgctcacgccgtacacgccgggcggcgcg
ctgcccgacgtcggcgccgcgcgccgatcgctcggcgatcgcgaccggctgcgccgcaat
cacgacgggtcggtcgacatcgtcgtgtcggcggcaccgggcgccgcgcgcgcggcgaac
tggctgccggcgccgcgcgccgatttcgcgctcgcgctgcggctgtatgcgccgaagccg
caggccaccgacggatcgtggatgccgccggccgtcgtgcgcaagtga

DBGET integrated database retrieval system