KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3306Help
Entry
Bmul_3306         CDS       T00624                                 

Definition
(GenBank) cytochrome d ubiquinol oxidase, subunit II
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:7.1.1.7]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00190  Oxidative phosphorylation
bmu01100  Metabolic pathways
bmu02020  Two-component system
Module
bmu_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bmul_3306
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bmul_3306
Enzymes [BR:bmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     Bmul_3306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_II
Motif
Other DBs
NCBI-ProteinID: ABX16990
UniProt: A0A0H3KP11
Position
2:complement(192479..193486)
Genome map
AA seq 335 aa AA seqDB search
MDVTVIWAAIIALGLFMYVVLDGFDLGIGIVFPFFPDEKERDLMMNTVAPVWDGNETWLV
LGGAGLFAVFPVVYSTVLSALYLPLIFMLVCLIFRGVSFELRAKARRTKHLWDLAFIGGS
AGATFFQGVALGAFLQGIDVKDGVFAGDAFDWLTPFSLLTGLGLIATYALLGCCWLVAKT
EGDLQRRLHRVVWPLTVVLLGFIAIVSLWTPLQDPAIAQRWFDTGLFWRLLPVPFLVAGC
AVWMRRAVRARHDMTPFVLALALVLLGYVGLLVSLFPYAIPQTLTIWEAAAPHSSQTFTL
VGAAVILPIIIAYTTMGYWVFRGKVRHEDQHYYHH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaccgtaatctgggccgcgatcatcgcattggggctcttcatgtacgtcgtg
ctcgacggcttcgacctcggcatcggcatcgtcttcccgttcttcccggacgagaaggaa
cgcgacctgatgatgaacacggtcgcgcccgtgtgggacggcaacgaaacgtggctcgtg
ctcggcggcgccgggctgttcgccgtgtttccggtcgtctattcgaccgtgctgtccgcg
ctctatctgccgctgatcttcatgctcgtctgcctgatcttccgcggcgtatcgttcgaa
ctgcgcgcgaaggcgcgccgcacgaaacatctgtgggatctcgcgttcatcggcggctcg
gccggcgcgacgttcttccagggtgtcgcgctcggtgcgttcctgcagggcatcgacgtg
aaggacggcgtgttcgccggcgacgcattcgactggctgacgccgttcagcctgctgacg
ggcctcggcctgatcgcgacctacgcgctgctcggctgctgctggctcgtcgcgaagacc
gagggcgacctgcagcgccggctgcatcgcgtcgtatggccgctgaccgtcgtgctgctc
ggcttcatcgcgatcgtcagcctgtggacgccgctgcaggatccggccatcgcgcagcgc
tggttcgatacggggctgttctggcggctgctgccggtgccgttcctcgtcgccggctgc
gcggtgtggatgcgccgcgcggtgcgcgcgcggcacgacatgacgccgttcgtgctcgca
ctcgcgctcgtgctgctcggctacgtcgggctgctcgtgtcgctgttcccgtacgcgatt
cctcagacgctgacgatctgggaagccgccgcgccacattcgagccagaccttcacgctg
gtcggcgcagcggttatcctgccgatcatcatcgcctacacgacgatgggttactgggta
ttccgaggcaaggtgcgccatgaagaccagcattactaccaccactga

DBGET integrated database retrieval system