KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3309Help
Entry
Bmul_3309         CDS       T00624                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly-zipper_OmpA Gly-zipper_YMGG
Motif
Other DBs
NCBI-ProteinID: ABX16993
UniProt: A0A0H3KPR7
Position
2:195753..196292
Genome map
AA seq 179 aa AA seqDB search
MKQTIRSLRAPAVLALTGLLGACAYLPAGPSVMALPGTGKTFDQFRVDDANCRQFALQQS
GGVNAAQASTASALGSAAVGTALGAAAGAAFNGGTGAAVGAGAGLLAGSVVGTGAAQGSA
YDVQRRYDYGYLQCMYAAGNRVPVPGAMSDAYGGNGGGVAPRAAPPLPPPGVQPPPPRY
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagacgattcgatcgctgcgcgcaccggccgtgctggcgctgaccggcctgctc
ggcgcatgcgcgtacctgccggccgggccgagcgtgatggcgctgccgggcaccggcaag
accttcgaccagttccgcgtcgacgacgcgaactgccggcagttcgcgcttcagcagtcg
ggcggcgtcaacgccgcgcaggcgtcgacggcgagcgcgctcggcagcgccgcagtcggc
acggcgctcggcgcggcggcgggcgccgcgttcaacggcggcaccggcgccgcggtcggt
gccggcgcggggctgctcgccggcagtgtggtcggcaccggtgccgcgcaaggttccgcg
tacgacgtccagcgccgctatgactacggctacctgcaatgcatgtacgcggccggcaac
cgcgtgccggtgccgggcgcgatgagcgacgcgtacggcggcaacggcggcggcgtcgcg
ccgcgcgctgcgccgccgctgccgccgcccggcgtgcaaccgccgccgccgcgatattga

DBGET integrated database retrieval system