KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3310Help
Entry
Bmul_3310         CDS       T00624                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00260  Glycine, serine and threonine metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmul_3310
Enzymes [BR:bmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Bmul_3310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABX16994
UniProt: A0A0H3KTV3
Position
2:196476..197489
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSQAMLAAMTAAEVGDDVWGDDPTVLRLQAATAERAGKEAGLFFPSGTQ
SNLAALMAHCERGDEYIVGQLAHTYKYEGGGAAVLGSIQPQPIENAPDGTLPLAKIAAAI
KPLDNHFARTRLLALENTIGGQVLPEGYVQEAVAFARSRGLSAHLDGARVCNAAVASGRS
IAELCAPFDTVSICFSKGLGAPVGSVLVGSRALIERAQRWRKVLGGGMRQSGILAAACLY
ALDHNVERLADDHANAAHLAEGLARIEPVKVLSQATNMVFAQFPEADCAPLEAWLKARGI
LTQMLYASRFVTHCDVSRADIDTFIDAVGAYFAQRRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttgcgcagcgataccgtgacacgtccgagccaggcgatgctggccgcgatg
actgccgccgaagtcggcgacgacgtttggggcgacgacccgaccgtgctgcgcctgcag
gccgccacggccgagcgggccggcaaggaagcggggctgttcttcccgagcggcacgcag
agcaatctggccgcgctgatggcgcattgcgaacgcggcgacgaatacatcgtcgggcag
ctcgcccacacgtacaaatacgaaggcggcggcgcggcggtgctcggcagcatccagccg
caaccgatcgagaacgcgcccgacggcacgctgccgctcgcgaagatcgcggccgcgatc
aagccgctcgacaaccacttcgcgcgcacgcgcctgctcgcgctcgagaacacgatcggc
ggtcaggtgctgccggaaggctacgtgcaggaagccgtcgcgttcgcgcgcagccgcggc
ttgtcggcgcacctcgacggcgcgcgcgtctgcaatgcggccgtcgcgtcgggccgctcg
atcgccgagctctgcgcgccgttcgataccgtgtcgatctgcttctcgaaggggctcggc
gcaccggtcggctcggtgctggtcggcagccgtgcgctgatcgagcgcgcgcagcgctgg
cgcaaggtgctcggcggcgggatgcggcagtcgggcattctcgcggcggcgtgcctgtat
gcgctcgaccacaacgtcgaacgcctggccgacgatcatgcgaacgccgcacatctcgcc
gaagggctcgcgcgcatcgaaccggtcaaagtgctctcgcaggcgacgaacatggtgttc
gcgcagttccccgaagccgattgcgcaccgctcgaggcctggctgaaggcgcgcgggatc
ttgacgcagatgctctacgcgtcgcgcttcgtcacgcactgcgacgtctcgcgcgcggac
atcgacaccttcatcgacgccgtcggcgcgtacttcgcccagcgtcgcgcgtga

DBGET integrated database retrieval system