KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3329Help
Entry
Bmul_3329         CDS       T00624                                 

Definition
(GenBank) 17 kDa surface antigen
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rick_17kDa_Anti Gly-zipper_Omp Gly-zipper_YMGG
Motif
Other DBs
NCBI-ProteinID: ABX17013
Position
2:212814..213401
Genome map
AA seq 195 aa AA seqDB search
MSAAGRRTGAILRRKLIEMNWFRDSAQCPNRRRPVQIRYERLLITLRTRKDTGMWKKIAP
ALVVAALAGATALPAAANDLNNALGGALGGVAGAAVGGAVGGSTGSVIGGALGGGAGGAI
TSNRRERTGAIIGGALGGGAGTAAGNAMGGRTGGLLGAAVGGGAGAALGGNMSRSSYDDD
RGYRHRKHRHHRHWD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggcaggccgcaggaccggtgctattcttcgccgcaagctcattgaaatgaat
tggtttcgcgattcggcccaatgcccgaatcgacgtcgaccggttcagatccgatacgag
cgactcctcataacattgcgaacaaggaaggatacgggcatgtggaagaagatcgccccc
gctctcgtcgtcgccgcactcgccggcgcgactgcgctgccggcggcagctaacgatttg
aacaacgcgcttggcggcgcgctcggcggggtagccggcgcggcggtcggcggcgcggtc
ggcggcagcacgggttccgtgatcggcggcgcgctcggcggcggcgcgggtggcgcgatc
acgtcgaaccgtcgcgagcgtaccggcgcgatcatcggcggcgcgctcggcggcggcgca
ggcaccgcggccggcaacgccatgggcggccgtacgggcggcctgctcggcgccgctgtc
ggcggcggcgcgggtgcggcgctcggcggcaacatgtcgcgcagctcgtacgacgacgat
cgcggctatcgtcatcgcaagcatcgccatcatcgtcactgggactga

DBGET integrated database retrieval system