KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3336Help
Entry
Bmul_3336         CDS       T00624                                 

Definition
(GenBank) periplasmic binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02010  ABC transporters
Module
bmu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bmul_3336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmu02000]
    Bmul_3336
Transporters [BR:bmu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Bmul_3336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: ABX17020
UniProt: A0A0H3KPP7
Position
2:complement(220885..221799)
Genome map
AA seq 304 aa AA seqDB search
MSARTFDPRRRAVLAAAAAGALAATAPARAIAAVQSAPKRVVVIGGALAETAFALGGEHA
HGYRLVGADTTCTYPEAAKRLPKVGYQRALSAEGLLSLRPDLVLASAEAGPPAAIAQVAR
AGVAVQTFDERHDADSVRKKIAGIAQALDMRDAGVALLRQFDRDWQAARDSVAAHVPGGA
QPPRVLFVLNHTGNQALVAGGRTAADAMIRYAGARNAMQGFDHYKPLTSEALAAAAPDVV
LISDEGLAAVGGRAALLAAPGFAATPAGRAQRIVSLDALLLLGFGPRLPLAVTTLHRRLS
DTLA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcgcacgttcgatccgcgccgccgcgcggtgctggccgccgcggccgctggc
gcgctcgcggcgacggcgcccgcgcgcgcgatcgcggccgtccagtcggcgccgaagcgc
gtcgtcgtgatcggcggcgcgctcgcggaaacggccttcgcgctcggcggcgagcacgca
cacggctaccggctcgtcggcgcagacaccacgtgcacgtatccggaggccgcgaaacgc
ttgccgaaggtcggctatcagcgcgcgctgtcggccgaaggtttgctgtcgttgcggccc
gatctcgtgctcgcgtcggcggaagccggcccgccggccgcgatcgcgcaagtcgcgcgt
gcgggcgtcgcggtgcagaccttcgacgagcgtcacgatgccgactcggtacgcaagaaa
atcgccggcatcgcgcaggcgctcgacatgcgcgatgccggcgtcgcgctgctgcggcag
ttcgatcgcgactggcaggccgcgcgcgattccgtcgccgcgcacgtgccgggcggcgcg
cagccgccgcgcgtgctgttcgtgctcaatcacaccggcaaccaggcgctcgtcgccggc
ggacgcacggcggccgacgcgatgatccgctacgccggcgcgcgcaacgcgatgcagggc
ttcgatcactacaagccgctgacgagcgaggcgctggccgccgccgcgcccgacgtcgtg
ctgatctccgacgaagggctcgccgcggtcggcgggcgcgcggcgctgctggccgcgccc
ggcttcgccgcgacgccggccggtcgcgcgcagcgcatcgtgtcgctcgacgcgctgctg
ctgctcggcttcggcccgcggctgccgctcgcggtcacgacgctgcatcggcgtctgtcg
gacacgctcgcgtaa

DBGET integrated database retrieval system