KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3337Help
Entry
Bmul_3337         CDS       T00624                                 

Definition
(GenBank) Haemin-degrading family protein
  KO
K07225  putative hemin transport protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemS ChuX_HutX
Motif
Other DBs
NCBI-ProteinID: ABX17021
Position
2:complement(221796..222926)
Genome map
AA seq 376 aa AA seqDB search
MRAGCTRVPPSVKESDMMQSPVSASSVRTSTSLRDAFVKLKRERRLRNRDVAQALGVSEG
EALAAFVGEHVVRLDARFPDLFEEMPRLGRVMALTRNDAAVHEKDGAYAQMSHDGPVGLA
LGDIDLRIFYRQWASAFAVRDDTPHGPLKSLQFFDAQGHAIHKVYLRAHSDHAEYDAFVA
RWRAASQQPGLDVAPAVPKKPERADSAIDVAGFRAAWHAMTDTHQFFGITQRFGVSRLQA
LRLADPQHAYPLDAARALRHVLERAAQTGQPIMVFVGNAGMIQIHTGPIANVREVGAWIN
VLDPGFNLHVREDMIATAWVVKKPTSDGIVTSVELFDRNGEHVALLFGERKPGQPERDDW
RALVASLAPAARGDAR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccggctgcacgcgcgtcccaccgtccgtcaaggagtccgacatgatgcaatcc
cccgtttccgcgtcgtccgtgcgcacgtccacctcgctgcgcgacgcgttcgtgaagctc
aagcgcgagcgccggctgcgcaaccgcgacgtcgcgcaggcgctcggtgtcagcgaaggc
gaagcgctcgccgcgttcgtcggcgagcacgtggtgcggctcgatgcgcgctttcccgat
ctgttcgaggaaatgccgcgtctcggccgcgtgatggcgctcacgcgcaacgacgcggcc
gtgcacgagaaggacggcgcgtacgcgcagatgagccacgatggccccgtcggtctcgcg
ctcggcgacatcgatctgcgcatcttctatcggcagtgggcgtccgcgttcgcggtgcgc
gacgacacgccgcacggcccgctgaaaagcctgcagttcttcgacgcgcagggccatgcg
atccacaaggtctatctgcgcgcgcacagcgatcacgccgagtacgatgcattcgtcgcg
cgctggcgcgcggcctcgcagcagccgggcctcgacgtcgcgccggccgtgccgaagaag
cccgagcgcgcggacagcgcgatcgacgtcgccggctttcgcgccgcgtggcacgcgatg
acggacacgcaccagttcttcggcatcacgcagcgtttcggcgtgagccgcctgcaggcg
ttgcgtcttgccgatccgcagcacgcgtatccgctcgatgccgcacgcgcgttgcgtcac
gtgctcgaacgcgcggcgcagaccggccagccgatcatggtgttcgtcggcaacgcgggg
atgatccagatccatacgggccccatcgcgaacgtgcgcgaagtcggcgcatggatcaac
gtgctcgatccgggcttcaacctgcacgtacgcgaggacatgatcgcgaccgcgtgggtc
gtgaagaagccgacgagcgacggcatcgtcacctcggtcgaactgttcgaccgcaacggc
gagcacgtcgcgctgctgttcggcgaacgcaagccggggcagccggagcgcgacgactgg
cgcgcgctcgtcgcgtcgctcgcgcctgccgcgcgcggggacgcacgatga

DBGET integrated database retrieval system