KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3339Help
Entry
Bmul_3339         CDS       T00624                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ODAM
Motif
Other DBs
NCBI-ProteinID: ABX17023
UniProt: A0A0H3KP93
Position
2:complement(225434..225661)
Genome map
AA seq 75 aa AA seqDB search
MNAQSLSGMLRAQELLLVSMVRTLPVDTRGALVDLFTEQIAFAEQAGLESRADRDVHDAF
VAHARNLLIRLESLA
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcaatcgctgtccggcatgctccgcgcgcaggagctgctgctcgtctcgatg
gttcgcacgcttcccgtcgacacccgcggcgcgctcgtcgatctcttcaccgaacagatc
gcattcgccgaacaggcggggctcgaaagccgcgccgaccgcgacgttcacgatgcgttc
gtcgcgcatgcgcgcaatctgctgattcgcctcgaatcgctcgcctag

DBGET integrated database retrieval system