KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3341Help
Entry
Bmul_3341         CDS       T00624                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2866
Motif
Other DBs
NCBI-ProteinID: ABX17025
UniProt: A0A0H3KPP3
Position
2:complement(226303..226563)
Genome map
AA seq 86 aa AA seqDB search
MIEDTVFSHLHTILTREHSLPVQSCRVSVEMQRPWGRPYRLVEWTMHLDAPARRQIVPAE
STDAEIAEVVASHVPGRLYGDGRLQF
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagataccgttttcagccatctgcacacgattctgacccgcgagcactcgtta
cccgtccagagctgtcgcgtgtccgtcgaaatgcagcgcccgtgggggcgcccgtatcgg
ctcgtcgaatggacgatgcatctcgatgcacccgcgcgacggcagatcgtgccggccgaa
tcgaccgacgcggaaatcgccgaagtcgtcgcgtcgcacgtgcccggccggctgtacggc
gacggccgcctgcagttctaa

DBGET integrated database retrieval system