KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3345Help
Entry
Bmul_3345         CDS       T00624                                 

Definition
(GenBank) HMG-I and HMG-Y DNA-binding domain protein
  KO
K07483  transposase
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Bmul_3345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_28 HTH_29 HTH_23 HTH_Tnp_1 HTH_32 DUF1804 DAO_C DUF1153 CENP-B_N LZ_Tnp_IS481 AT_hook
Motif
Other DBs
NCBI-ProteinID: ABX17029
UniProt: A0A0H3KD18
Position
2:230550..231077
Genome map
AA seq 175 aa AA seqDB search
MTKYDERFRRRVVQAYLAGEAGTKTLAHRYGVGSTMVRRWVASYREHGEDGLSKKHSHYD
ARFKLSVLQRMWRDELSYARVAVVFGIRNERSIPVWERLYHEGGIEALMPRRRGRPPKMT
TLPPPKPTDDAAQKEPSREELLKEIVYLRAEVAYLKKLDALLQSKKQTAPRKKRK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagtacgacgaacgtttccgacgtcgggtggttcaggcgtatctggctggagag
gctgggaccaagacacttgcgcatcgttacggcgtgggtagcacgatggtccgacgttgg
gtggcgagctatcgcgagcatggcgaagacggactgagcaagaagcacagccactacgac
gcgcgattcaagctatcggtgctccaacggatgtggcgcgatgagttgtcatatgcccga
gtggcggtggtattcggcattcgcaatgaacggagcatcccggtttgggagcgcctgtat
catgagggcggtatagaagccctgatgcctcgtcgccgaggacgtcccccgaagatgacc
accttgccgccaccgaagcctaccgatgatgccgcgcagaaagagccgagccgcgaggaa
ctgctcaaggaaatcgtgtatttgcgcgcggaggtggcgtacctaaaaaagctcgatgcg
ctgctgcaatcaaagaagcagacagcgcccaggaaaaaacgcaaataa

DBGET integrated database retrieval system