KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3346Help
Entry
Bmul_3346         CDS       T00624                                 

Definition
(GenBank) Integrase catalytic region
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_2 HTH_21 rve_3 DDE_Tnp_IS240
Motif
Other DBs
NCBI-ProteinID: ABX17030
UniProt: A0A0H3KF33
Position
2:231167..231913
Genome map
AA seq 248 aa AA seqDB search
MDAGDRYAELKVKIRSVYDHHKGRYGYRRITTVIRQAGHAINHKTVQRLMGQLQLKSLVR
PKRYRSWRGEVGRVAPNLLRRQFDAERPNQKWVTDVTEFNVGGQKLYLSPVMDLYNGEIV
AYQMDERPSFELVSGMLKKAVAKLDDEGRPLLHSDQGWQYQMPAYRRLLKQHALTQSMSR
RGNCLDNAAMESFFGTLKSECYRLARFANVEQLRDALSRYIHYYNHERIKLKLNGLSPVQ
YRTQPSAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttggatgctggcgatcggtatgcggagctcaaagtgaagatccggagcgtgtacgaccac
cacaagggccgttacggctatcggcgaatcacgacagtgatccggcaagcgggacacgcg
atcaatcacaagaccgtgcagcggttgatgggacaactgcagttgaaatctctggtacgc
ccgaagagatatcgttcctggcgaggcgaagtcggccgcgttgccccaaatctactgcgg
cggcagtttgatgctgaacgcccgaatcagaaatgggtgaccgacgtgaccgaattcaat
gtagggggccaaaagctctatctgtcgccggtgatggacttgtacaacggggagatcgtc
gcttaccaaatggatgagcgcccgagcttcgagttggtcagcggcatgttgaagaaggcg
gtggccaagctcgatgatgaaggacggccgttactgcattcggatcaaggctggcagtat
cagatgcccgcctaccgtcggttgttgaagcagcatgcgctcacccagagcatgtcgcgc
agaggcaactgccttgataacgcagccatggagagcttcttcggcacgctgaaatccgag
tgctatcggctggcgcgctttgcgaacgtggagcagttgcgagatgcgttgagccgctac
attcactactacaaccacgaacgcatcaagctcaaattaaacgggctgagtcccgtgcaa
tacaggactcagccctcggccgcttag

DBGET integrated database retrieval system