KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3351Help
Entry
Bmul_3351         CDS       T00624                                 

Definition
(GenBank) aldo/keto reductase
  KO
K06222  2,5-diketo-D-gluconate reductase B [EC:1.1.1.346]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bmul_3351
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.346  2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming)
     Bmul_3351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: ABX17035
UniProt: A0A0H3KPN5
Position
2:complement(237415..238221)
Genome map
AA seq 268 aa AA seqDB search
MNPIPAFGLGTYRLKGQVVIDSVRNGLELGYRAIDTAQIYGNEAEVGEAIAASGVSRDAL
FLTTKIWVDNYAPDKLVPSLEDSLRKLRTDYVDLTLIHWPAPDNGVPLATFMTALADAQA
KGLTRRIGISNFNIALTKEAIAAVGKDAIATNQIELSPYLQNRKLVEFLNAEGIHVTSYM
TLAYGKVLGDPVLGAIAKRHDATPAQVALAWAMQLGYSVIPSSTKRENLASNLLAQTLRL
TDDDMAQIAALERNGREVDPAGLAPKWD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccattcccgcattcggcctcggcacgtatcgcctgaagggccaggtcgtcatc
gactcggtccgcaacggcctcgaactcggctaccgtgcgatcgacaccgcgcagatctac
ggcaacgaagccgaagtcggtgaggcgatcgccgcgtcgggcgtcagccgcgacgcgctg
ttcctgacgacgaagatctgggtcgacaactatgcgcccgacaagctcgtgccgagcctc
gaggacagcctgcgcaagctgcgcaccgactacgtcgacctgacgctgatccactggccg
gcgcccgacaacggcgtgccgctcgcgacgttcatgaccgcgctcgccgacgcgcaggcg
aagggcctcacgcgccggatcggcatctcgaacttcaacatcgcgctgacgaaggaggcg
atcgcggcggtcggcaaggacgcgatcgcgacgaaccagatcgaactgagcccgtatctg
cagaaccgcaagctcgtcgaattcctgaacgccgaaggcatccacgtgacgtcgtacatg
acgctcgcctacggcaaggtgctcggcgacccggtgctcggcgcgatcgcgaagcgccac
gatgcgacgcccgcgcaggtcgcgctcgcctgggcgatgcagctcggctactcggtgatt
ccgtcgtcgacgaagcgcgaaaacctcgcgagcaacctgctcgcgcaaacgctgcgcttg
accgacgacgacatggcgcagatcgccgcgcttgagcgcaacggccgcgaagtcgatccg
gccggcctcgcgccgaagtgggactga

DBGET integrated database retrieval system