KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3358Help
Entry
Bmul_3358         CDS       T00624                                 

Definition
(GenBank) amidohydrolase
  KO
K01451  hippurate hydrolase [EC:3.5.1.32]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00360  Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Bmul_3358
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bmu01002]
    Bmul_3358
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.32  hippurate hydrolase
     Bmul_3358
Peptidases [BR:bmu01002]
 Metallo Peptidases
  Family M20
   Bmul_3358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABX17042
UniProt: A0A0H3KTR7
Position
2:243871..245058
Genome map
AA seq 395 aa AA seqDB search
MTDTRFTEIEDLLPAAGALREIRHHIHSHPELAYEEHDTAALVADKLEQWGWQVTRGVGK
TGVVGTLRVGDGTRSIGIRADMDALPIVEATGLPYASATHGKMHACGHDGHTTMLLGAAQ
HLAKTRRFSGTVHLYFQPAEEHGVDSGAKKMIDDGLFERFPCDAVFGMHNHPGAAPGVFL
TRRGPFMSAGDKAIITIEGVGGHAARPHLTVDPVVVAASIVMALQTIVARNVDPAQPAVV
TVGSMHAGTANNVIPNGARLELSVRSFSPDVRALLKRRIVELAETQAASYGATAQVEYIE
GYPVVVNTDAETDFAAQVARELVGDAQVVEQADLLMGSEDFAFMLQQRPGSFVRLGNGEG
EDGCMVHNPKYDFNDRNLPIGAAFWARLVERYLAQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacccgcttcaccgaaatcgaggatctgctgcccgccgccggcgcgctgcgc
gagatccgccatcacatccacagtcaccccgaactcgcgtacgaggagcacgacacggcc
gcgctcgtcgcggacaagctcgagcagtggggctggcaggtcacgcgcggcgtcggcaag
accggcgtggtcggtacgctgcgtgtcggcgacggcacgcgcagcatcggcatccgcgcc
gacatggacgcgttgccgatcgtcgaggcgaccggcctgccgtatgcgagcgcgacgcac
ggcaagatgcatgcatgcggtcatgacggccacacgacgatgctgctcggcgccgcgcaa
catctcgcgaagacgcgccgtttctccggcaccgtgcatctgtatttccagcccgcggaa
gagcatggcgtcgacagcggcgcaaagaagatgatcgacgacggtctgttcgaacgcttc
ccgtgcgacgccgtgttcggcatgcacaaccatccgggcgcggcgccgggcgtgtttctc
acgcggcgcgggccgttcatgtcggccggcgacaaggcgatcatcacgatcgaaggcgtc
ggcggccatgcggcgcgtccgcatctgacggtcgacccggtcgtcgtcgcggcgagcatc
gtgatggcgctgcagacgatcgtcgcgcgcaacgtcgatcccgcgcagccggcggtcgtg
acggtcggatcgatgcacgcgggcaccgcgaacaacgtgattccgaacggcgcgcgcctc
gagctgagcgtgcgctcgttcagccccgacgtgcgcgcgctgctgaagcgccgcatcgtc
gaactcgccgaaacgcaggccgcgagctacggcgcgacggcgcaggtcgagtacatcgag
ggctatccggttgtcgtcaatacggatgccgaaacggatttcgcggcgcaggtcgcgcgc
gaactcgtcggcgacgcgcaggtggtcgagcaggccgatctgctgatgggcagcgaggat
ttcgcgttcatgctgcagcagcggcccggttcgttcgtgcggctcggcaacggcgaaggc
gaggacggctgcatggtccacaacccgaagtacgacttcaacgaccgcaatctgccgatc
ggcgccgcgttctgggcgcgcctcgtcgagcgttatctcgcgcagtga

DBGET integrated database retrieval system