KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3359Help
Entry
Bmul_3359         CDS       T00624                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K03762  MFS transporter, MHS family, proline/betaine transporter
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmu02000]
    Bmul_3359
Transporters [BR:bmu02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Metabolite:H+ symporter (MHS) family [TC:2.A.1.6]
    Bmul_3359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ABX17043
UniProt: A0A0H3KNX8
Position
2:245112..246434
Genome map
AA seq 440 aa AA seqDB search
MQKDPVALHPAHAAAMAVGAPAGTRRGAIAAAVIGNWLEFFDFTVYGFFAVLIGKLFFPS
SDATTSLLLSVATFAAGFFTRPLGSVVLGVYADRKGRKAALNLTIMLMAIGTGLIAIAPT
YAQIGVAAPLLVVCARLMQGFSQGGEFGAATSTLLEQGGASRRAFRASWQLATQGGAALM
GSGFAALLSNTMTKAALESWGWRLPFLVGVLIAPVGMFLRRRLADDAPADRHHSIERGVL
RELFSKHARTVLLLMLTVMGGTVSTYILTFYMPTYAIHTLGLPMKLSMFVGVASGCVMLV
TCPLFGWLSDRIGSRRLPIFVGRGVLVALLFPAFWLMNHHPSLSVILPLTALMLLFYSLG
SASEMALMCESLPRHVRATGISIAYALAVTLFGGTAQLIATWLVKVTGSKLAPAGYVAAC
VVLSLIAVAMLRETAHESMD
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagaccctgtcgcgctgcaccccgcgcacgccgcggcgatggccgtcggcgcg
ccggccggcacgcgccgcggcgcgatcgcggcggccgtgatcggcaactggctcgaattc
ttcgacttcaccgtgtacggctttttcgcggtgctgatcggcaagctgttctttccgtcg
agcgatgcgacgacgtcgctgctgctgtcggtcgcgacgttcgcggccggcttcttcacg
cggccgctcggcagcgtcgtgctcggcgtgtacgcggaccgcaagggacgcaaggccgcg
ctgaacctgacgatcatgctgatggcgatcggcaccgggctgatcgcgatcgcgccgacc
tatgcgcagatcggcgtggctgcaccgctgctcgtcgtctgcgcgcggctgatgcagggc
ttctcgcaaggcggcgaattcggcgcggcgacctcgacgctgctcgaacaaggcggcgcg
tcgcgccgcgcgtttcgcgcgagctggcagctcgcgacgcagggcggcgccgcgctgatg
ggttcgggcttcgcggcgctgctgtcgaacacgatgacgaaggccgcgttggaaagctgg
ggctggcgcctgccgtttctcgtcggcgtgctgatcgcgccggtcggcatgttcttgcgc
cgccggctcgcggacgatgcgcccgccgaccgccatcactcgatcgaacgcggcgtgctg
cgcgagctgttctcgaagcacgcgcgcacggtactgctgctgatgctgacggtgatgggc
ggcacggtgtcgacgtacatcctgacgttctacatgccgacctacgcgatccatacgctc
gggctgccgatgaagctgtcgatgttcgtcggcgtcgcgtcgggctgcgtgatgctcgtc
acgtgcccgctgttcggctggctgtcggaccgcatcggcagccgccgcctgccgatcttc
gtcggccgcggcgtgctcgtcgcattgctgttcccggcgttctggctgatgaaccatcat
ccgtcgctgtcggtgatcctgccgctgaccgcgctgatgctgctgttctattcgctcggc
tccgcatcggaaatggcgctgatgtgcgaatcgctgccgcgtcacgtgcgcgcgaccggc
atttcgatcgcctatgcgctcgcggtgacgctgttcggcggcaccgcgcagctgatcgcg
acctggctcgtgaaggtgacggggagcaagctggcgccggccggctacgtcgcagcgtgc
gtcgtgctgtcgctgatcgcggtcgcgatgctgcgcgagaccgcgcacgaatcgatggac
tga

DBGET integrated database retrieval system