KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3365Help
Entry
Bmul_3365         CDS       T00624                                 

Definition
(GenBank) transcriptional regulator, GntR family with aminotransferase domain
  KO
K00375  GntR family transcriptional regulator / MocR family aminotransferase
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmu03000]
    Bmul_3365
Transcription factors [BR:bmu03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    Bmul_3365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GntR HTH_Crp_2 Rrf2 Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID: ABX17049
UniProt: A0A0H3KP72
Position
2:253953..255464
Genome map
AA seq 503 aa AA seqDB search
MRASVLSDWLAQRLVRGGEQPIYRQLHRLLQQAILSRELPAGARVPSSRLLAAELGIARN
TVTQVYEQLALEGYVHSATGRGTFVADSAPDEIVGAPPETGARHAAVQPSARALSARGTR
LVEGAGVSKRQGGAFMPGVPDVSRFPARVWTRLHNKYWRRLRPDLLTYAPGGGLALLREA
LADYLRTSRSVRCTPEQIVITTGIHQSIDLAVRLLTDPGDAIWTEDPCYWGVRSVLNVSG
LTTRPIPVDDEGIAPSAADLAEPPKLMLVTPSHQYPLGMVMSLARRRMLLEYARQHGCWI
IEDDYDSEFRYGSRPLASLQGLDTAGQVIYVGSFGKTLFPGLRVGYLVAPEPLAESFATA
SAELYREGQLLQQAVLAEFIAEGHFVSHIRKMRTLYGQRREVLLDAVARRYGDALQALGS
DAGLHLVTRLPDGVDDRAVAQAALERNIVVRPLSGYYADRARASSGLLLGYACVPEDEIE
TAFATLAEAIDARAFVGPDTAAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaagcgtgttgtcggactggcttgcgcagcgcctcgtgcgcggcggcgagcag
ccgatctaccggcagctgcatcggctgctgcagcaggcgatcctgtcgcgcgaactgccg
gccggcgcgcgcgtgccgtcgtcgcggctgctcgcggccgagctcgggatcgcgcgcaac
acggtcacgcaggtgtacgagcagctcgcgctcgaaggctatgtgcattcggcgaccggc
cgcggcacgttcgtcgccgacagcgcgcccgacgagatcgtcggcgcgccgccggagacg
ggcgcgcggcatgcggccgtgcagccgtcggcgcgcgcgttgtcggcgcgcggcacgcgg
ctcgtcgaaggcgccggcgtgtcgaagcggcagggcggcgcgttcatgccgggcgtgccc
gatgtgtcgcgatttccggcgcgcgtgtggacgcggctgcacaacaagtactggcggcgg
ctgcgccccgatctcctgacttacgcgccgggcggcgggctcgcgctgctgcgcgaggcg
ctggccgactatctgcgcacgtcgcgctcggtgcgctgcacgcccgagcagatcgtgatc
acgaccggcatccaccagtcgatcgacctggcggtgcggctgctgaccgatcccggcgac
gcaatctggaccgaggacccgtgctattggggcgtgcgcagcgtgctgaacgtgtcgggg
ctcacgacgcggccgattccggtcgacgacgaagggatcgcgccgagcgccgccgatctc
gccgagccgccgaagctgatgctcgtcacgccgtcgcatcagtatccgctcggcatggtg
atgagcctcgcgcggcggcggatgctgctcgaatatgcgcgccagcacggctgctggatc
atcgaggacgactacgacagcgagttccgctacggcagccggccgctcgcgtcgctgcag
ggcctcgatacggccgggcaggtgatctacgtcggcagcttcggcaagacgctgtttccg
ggcctgcgcgtcggctatctggtggcgccggagccgctcgcggaaagcttcgcgaccgcg
agcgccgagctctatcgcgaaggtcagctgctgcagcaggcggtgctcgcggagttcatc
gccgaagggcatttcgtgtcgcacatccgcaagatgcgcacgctgtacggccagcgccgc
gaggtgctgctcgacgcggtcgcgcgccgctacggcgacgcgctgcaggcgctcggcagc
gatgcggggctgcatctcgtcacgcggctgccggacggtgtcgacgatcgcgcggtcgcg
caggccgcgctcgaacgcaatatcgtcgtgcggcccttgtccggctattacgcggatcgt
gcacgcgcgtcgtcgggactgctgctcggttacgcgtgcgtgcccgaagacgagatcgag
acggcgttcgcgacgcttgcggaagcgatcgatgcgcgggccttcgttgggcccgacacc
gcggccgcgtag

DBGET integrated database retrieval system