KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3372Help
Entry
Bmul_3372         CDS       T00624                                 

Definition
(GenBank) Alpha/beta hydrolase fold-3 domain protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 COesterase Abhydrolase_6 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: ABX17056
UniProt: A0A0H3KPL7
Position
2:261537..262397
Genome map
AA seq 286 aa AA seqDB search
MDASEFSKFLKSALPAEARAGAALAVTELEIPGYAQDIALRLYRRPDKTGLPVVLYFHGG
GFVRGTLDDADFAARFLAERLPALVVSVDYSLAPAFPFPAAPEDAYRAAVWAATRARAFG
GNPKKIGVAGHDAGGQLANCLAFIARDRGDVPIVAQALFGPMLDPSMTRIGDAERLASDI
TARECAACYRAYLPQASQRMHPYAAPLESVRLSGLPPTLIVTAQNDVLHVEAEKYAGCLI
SSGVLTQVIRYPDVTHAALATHEAAFDEAVRFFQCRFQARQPNRNE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttccgaattcagcaaattcctgaaatccgcactgcccgccgaagccagagcc
ggcgcggcactggcggtcacggagctggaaattccgggctacgcgcaggacatcgcgctg
cgcctctatcgccgccccgacaagaccgggttgccagtagtgctttatttccacggcggc
ggtttcgtgcgcggcacgctcgacgacgcggatttcgccgcgcgctttttagcagaacgc
ttaccggcgctcgtagtgtcggtcgactattcgctcgcgcccgcgtttccgtttccggcc
gcgccggaagacgcgtatcgcgcggccgtctgggccgcgacgcgcgcccgtgcgttcggc
ggcaatccgaagaagatcggcgtcgcgggacacgacgcgggcggacagctcgcgaactgt
ctcgcgttcatcgcgcgcgatcgcggcgacgtgccgatcgtcgcgcaggcgctgttcggg
ccgatgctcgacccgagcatgacgcgcatcggcgatgccgaacgtctcgcgtcggacatc
accgcacgcgaatgcgcggcctgttatcgcgcctatctgccgcaggcgtcgcaacgcatg
catccgtacgcggcgccgctcgagtcggtgcgcctctcggggctgccgccgacgctgatc
gtcaccgcgcagaacgacgtgctgcacgtcgaagcggagaaatacgcgggctgcctgatt
tcgtcgggcgtgctgacgcaggtgatccgctatccggacgtcacgcatgccgcgctcgcg
acgcacgaagccgccttcgacgaagccgtgcgcttcttccagtgccgcttccaggcgcgc
cagccgaatcgcaacgaataa

DBGET integrated database retrieval system