KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3376Help
Entry
Bmul_3376         CDS       T00624                                 

Definition
(GenBank) transcriptional modulator of MazE/toxin, MazF
  KO
K18841  mRNA interferase ChpB [EC:3.1.-.-]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bmu02048]
    Bmul_3376
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Bmul_3376
Prokaryotic defense system [BR:bmu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   ChpB-ChpS
    Bmul_3376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PemK_toxin
Motif
Other DBs
NCBI-ProteinID: ABX17060
UniProt: A0A0H3KX85
Position
2:complement(268602..268952)
Genome map
AA seq 116 aa AA seqDB search
MVKRVKFERGDIVRVSPNPTLGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARF
AGFAVPLSGAGTETQGVALVNMIRMLDLEARGARKVERAPVEVVEDALARLQTIIE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcgcgtcaagttcgagcgaggcgatatcgtgcgcgtgagcccgaatccgact
ctcggtcgtgagcagcagggcgactttcgtccggcgctggtgctctccccggcagcgttc
aacgctttgggcgttgcgctggtcgcaccgatcacccagggtggcgaatttgcgcggttc
gcagggttcgcggtcccgctgtccggtgcaggaaccgagacgcagggcgtcgcgctggtg
aacatgattcgcatgctcgacctggaggcgcgcggcgctcgcaaggtcgaacgcgcgcct
gtcgaggtcgtggaagatgcactcgcccggcttcagacgatcatcgaataa

DBGET integrated database retrieval system