KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3382Help
Entry
Bmul_3382         CDS       T00624                                 

Definition
(GenBank) transmembrane pair domain protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BTP Colicin_V Phage_holin_2_4
Motif
Other DBs
NCBI-ProteinID: ABX17066
UniProt: A0A0H3KPL1
Position
2:274338..274778
Genome map
AA seq 146 aa AA seqDB search
MQGWKRRVVYVVMFEVLGILIASTVLGALSGASVETSGLLGVMISTTGVTVNFLYNLAFE
AWERRRAATTRTIGRRVAHAIGFQVALVTFLIPLIAWWLGVSLLQAFLFDAVLIVFFPIF
TFVYNWSFDYVFGLPDAVTRNGEPAA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcagggctggaagagacgcgtcgtctacgtcgtgatgttcgaggtgctcgggatcctg
atcgcatcgacggtgctcggcgcgttgagcggcgcgagtgtggagacgagcggtctgctc
ggcgtcatgatctcgacgacgggcgtcaccgtcaatttcctctacaacctcgcgttcgag
gcatgggaacggcggcgcgcggcgacgacgcggacgatcggccgccgcgtcgcgcatgcg
atcggattccaggtcgcgctcgtgaccttcctgattccgctgattgcgtggtggctgggc
gtatcgctgctgcaggcgtttttgttcgacgcggtgttgatcgtgttcttcccgatcttc
acgttcgtctacaactggtcgttcgattacgtgttcggcctgccggatgccgtgacgcgc
aacggtgagccggcggcttga

DBGET integrated database retrieval system