KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3383Help
Entry
Bmul_3383         CDS       T00624                                 

Definition
(GenBank) alpha/beta hydrolase fold
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Thioesterase Chlorophyllase2 Hydrolase_4 Chlorophyllase Esterase DUF2974 DUF1057
Motif
Other DBs
NCBI-ProteinID: ABX17067
UniProt: A0A0H3KTP5
Position
2:complement(274921..275775)
Genome map
AA seq 284 aa AA seqDB search
MNMRIEPSVLANPDLQFATLSSGISLPYVEQGSGAPMVFVHGSLCDYRYWDPQLAALSAH
YRCIAPSLSHYWPAVEAGIQDEFSWQNHVDELAEFIDALDLGPVHLVGHSRGGSVAFNVA
RQHPHLVESLTLADPGGPLQRDGVREEAKLPAAAMALRTKAVELIGSGSVEAGLEMFVDS
VSLPGAWKKSTARFRAMAIDNASTLPKQLRDPLPAYSASTAGDIACRTLLIDGQRSPKMF
RNNVETLSQWIPNAQRQTVAGASHGMNAASPAVFNRFVHEFVAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcgaatcgagccttcggtgctcgcgaatccggacctgcagtttgcgacgctg
tcgtcgggcatcagcctgccgtatgtcgagcagggcagcggcgcgccgatggtgttcgtt
catggttcgctctgcgattaccgctactgggatccccagctcgcggcgctgtcggcccac
taccgctgcatcgccccgagcctcagccactactggccggccgtcgaagccggcatccag
gacgagttcagctggcagaaccacgtcgacgagctcgccgaattcatcgacgcgctcgat
ctcggccccgtgcacctcgtcggccactcgcgcggcggcagcgtcgcgttcaacgtcgcg
cgccagcatccgcacctcgtcgagtcgctgacgctcgccgatccgggcggcccgctgcaa
cgcgacggcgtgcgcgaggaggcgaagctgccggcggccgccatggcgctgcgcacgaag
gcggtggagctgatcggcagcggcagcgtcgaggcgggcctcgaaatgttcgtcgattcg
gtgagcctgcccggtgcatggaagaagagcacggcgcgcttccgcgcgatggcgatcgac
aacgcaagcacgctgccgaagcagctgcgcgatccgctgcccgcgtattcggcgagcacc
gcgggcgatatcgcctgccgcacgctgctgatcgacggccagcgcagcccgaagatgttc
cgcaacaacgtcgagacgctgtcgcaatggatccccaacgcgcaacggcagaccgtcgcc
ggcgcgtcgcacgggatgaacgcggcaagcccggccgtgttcaaccgcttcgtgcacgag
ttcgtcgcggcgtaa

DBGET integrated database retrieval system