KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3387Help
Entry
Bmul_3387         CDS       T00624                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3579
Motif
Other DBs
NCBI-ProteinID: ABX17071
Position
2:complement(277922..278251)
Genome map
AA seq 109 aa AA seqDB search
MDRIDITEHGRLDGFLIRGITHAQKTFRPSDWPERLAGVITLFVGERRPGYPCALTRLAM
PVVDGGVKCLFVSGELRAVCADAFEFAMQFAADNDLPVEVKTAPVLAVR
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcatcgacatcaccgaacacggccgcctcgacggcttcctgatccgcggcatc
acgcacgcgcagaaaaccttccggcccagcgactggcccgagcgcctcgccggcgtgatc
acgctgttcgtcggcgagcggcggcccggttatccgtgcgcgctgacgcggctggcgatg
cccgtcgtcgacggcggcgtcaaatgcctgttcgtgtcgggcgagctgcgcgccgtgtgc
gcggatgcgttcgagttcgcgatgcagttcgcggcggataacgatctgccggtcgaggtg
aagacggcgccggtgttggcggtgcggtga

DBGET integrated database retrieval system