KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3390Help
Entry
Bmul_3390         CDS       T00624                                 

Definition
(GenBank) Citrate carrier protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2HCT
Motif
Other DBs
NCBI-ProteinID: ABX17074
UniProt: A0A0H3KP54
Position
2:complement(281694..283058)
Genome map
AA seq 454 aa AA seqDB search
MQTSIPTPSHPESVVEAGSTARTRFWPEGWWKLMEIGIGIIPLPVYLILFALIVGFAVTG
KVPGEISMAIAVLAFFGFTCAELGKRLPLLRNIGAAAIFATFVPSALTYYHVLPKPVLNL
TVEFTKSTNFLYLFIASIIVGSILSMDRRVLIQGFLKIFVPLALGSVAAAIVGTAVGTAL
GLGARHTLLYIVVPIMAGGVGEGAIPLSIGYSEILHLPQGEMFAMVLPSVMLGSLTAIIL
SGALDMLGKRLPHLTGNGRLQVGETGDMTPEHEEKRGLVDVTHIAGAGITAITLYLVGLM
AHKLFGLPAPVAMLFLAVLVKLARAVSPPLQEGAFVVYKFFSTAVTYPLLFAIGVAMTPW
DKLTAAFTLVNVVTIVATVATLMGTGFVVGRLLKMYPIDTAIVNACHSGQGGTGDVAILT
AANRMQLMPFAQIATRIGGAIVVTVTLILLAHFG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
ttgcagacctcaatccctaccccgtcccatccggaatcggtcgtcgaagccggttcgacc
gcgcgcacgcgcttctggcccgaaggctggtggaagctgatggaaatcggcatcggcatc
attccgctgccggtctacctcatcctgttcgcgctgatcgtcggcttcgcggtgacgggc
aaggtgcccggcgaaatctcgatggcgatcgcggtgctcgcgttcttcggcttcacgtgc
gcggaactcggcaagcgtctgccgctgctgcgcaatatcggcgcggccgcgatcttcgcg
accttcgtgccgtcggcgctcacctactatcacgtgctgccgaagccggtgctgaacctg
accgtcgaattcacgaagtcgacgaacttcctgtacctgttcatcgcatcgatcatcgtc
ggcagcatcctgagcatggatcgccgcgtgctgatccagggcttcctgaagatcttcgtg
ccgctcgcgctcggctcggtcgccgcggcgatcgtcggcacggccgtcggcaccgcgctc
ggcctcggcgcgcgccacacgctgctgtacatcgtcgtgccgatcatggccggcggcgtc
ggcgaaggcgcgatcccgctgtcgatcggctattcggaaatcctgcatctgccgcaaggc
gagatgttcgcgatggtgctgccgtcggtgatgctcggcagcctgaccgcgatcatcctg
tcgggcgcgctcgacatgctcggcaagcgcctgccgcatctgaccggcaacggccgcctg
caggtcggcgaaaccggcgacatgacgccggaacacgaggaaaagcgcggcctcgtcgac
gtgacgcatatcgcgggcgccggcatcaccgcgatcacgctgtacctcgtcgggctgatg
gcgcacaagctgttcgggctgccggcgccggtcgcgatgctgttcctcgcggtgctcgtg
aagctcgcgcgtgccgtgtcgccgccgctgcaggaaggcgcgttcgtcgtctacaagttc
ttctcgactgccgtcacgtatccgctgctgttcgcgatcggcgtcgcgatgacgccgtgg
gacaagttgaccgccgcgttcacgctcgtcaacgtcgtgacgatcgtcgcgaccgtcgcg
acgctgatgggcaccggtttcgtggtcggccgcctgttgaagatgtaccctatcgacacc
gcaatcgtgaacgcctgccacagcgggcaaggcggcaccggcgacgtcgcgatcctgacc
gccgcgaaccggatgcagctgatgccgttcgcgcagatcgcgacgcgcatcggcggcgcg
atcgtcgtcacggtcacgctgatcctgctcgcgcacttcggatga

DBGET integrated database retrieval system