KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3403Help
Entry
Bmul_3403         CDS       T00624                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_Crp_2 HTH_24
Motif
Other DBs
NCBI-ProteinID: ABX17087
UniProt: A0A0H3KTJ7
Position
2:complement(296888..297802)
Genome map
AA seq 304 aa AA seqDB search
MRSSSEKLSGSISVFAAVVDAGTFVGAAEVIGMTPPGVSRAIARLEKRLNVRLFNRTTRS
VSLTEEGRRFYEQVMPHLAGLEEAAAAAAGGASAVRGKLRINLDPVVYRTVLGQPLDAFM
DTHPELEIEFIARDSLGDLVMDGFDLAVRFGEPKASTLIARKLLDSRIVTVAAPSYVARW
GRPAKPEDLEGRRHRCLEFRNPETGKPFQWEFHRKRKRIVVNTQGRLTVNDPGALLNACL
AGSGIAQMLLLGAEPLIADGRLINLFPEWVDERYPLYVYYASRHHVPAKTRAFLDFVVEL
MRNH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagatccagtagcgagaaactttccggcagcattagcgtgttcgccgccgtagtggat
gcggggacctttgtgggcgctgcggaggtgataggaatgacgccgccgggcgtcagtcgc
gcgattgcgcggctggaaaagaggttaaacgtccggctcttcaaccggacaacgcgctct
gtctccctgactgaagagggccgccgcttttacgagcaggtcatgccccatctggccggc
cttgaggaagcggcggccgctgcggcgggtggcgcgtccgctgtgcgtggaaagctgaga
atcaatctggaccctgtcgtctaccggaccgttctcgggcagccactcgatgcgttcatg
gacacacacccggaactcgaaatcgagttcatcgcgcgggacagtcttggcgacctcgtc
atggacggcttcgacctcgccgtccgattcggcgaacccaaagcctccacgctgatcgca
agaaagctgctcgactcccgcatcgtgacagttgcagcaccgtcgtacgttgcacgttgg
ggacggccggcaaaacccgaggacctggaaggtcgacgccacagatgcctcgaatttcga
aacccggagactggcaagccgttccagtgggaattccatcgcaaacgaaaacgcattgtg
gtgaacactcagggacgactcacggtcaacgacccgggcgctctgcttaacgcatgtctc
gccggttccgggattgcgcagatgttgctgctcggtgccgagcccctgattgccgacggg
cggttgatcaatctctttcccgaatgggtagacgaacggtatccgttatacgtctactac
gcatcccggcaccacgtgccggcaaagacccgcgcttttctggacttcgtggtggaactg
atgcgcaatcactaa

DBGET integrated database retrieval system