KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3415Help
Entry
Bmul_3415         CDS       T00624                                 

Definition
(GenBank) hypothetical protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABX17099
Position
2:complement(307779..308087)
Genome map
AA seq 102 aa AA seqDB search
MHREPRARVRARWRTTVGAGRSARDAARGARSPPRHSTHAATTVPTRAAPRQAAIVESPA
RRVLAGLRTRDDDFRIYQGNRRYAEIVAAHAPNAQDVRIFAT
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcgagccgcgggcacgcgtgcgcgcacggtggcgcacgacggtcggcgcggga
cggtcggcgcgggacgcggcgcgcggcgcacgcagcccgccgcggcattcgacgcatgcg
gccacgacggtgccgacgcgtgccgcgccgcggcaggccgccatcgtagaaagcccggcg
cgccgcgtcttggccggattacgcacgcgggatgacgatttccgcatatatcagggtaat
cgacgatatgccgaaatcgtcgcggcccacgcaccgaacgcgcaagacgtgcgcattttc
gctacctag

DBGET integrated database retrieval system