KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3416Help
Entry
Bmul_3416         CDS       T00624                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC PAS_4 PAS_9 PAS PAS_8 HTH_3 sCache_3_2
Motif
Other DBs
NCBI-ProteinID: ABX17100
UniProt: A0A0H3KNT3
Position
2:308144..308983
Genome map
AA seq 279 aa AA seqDB search
MTPTLAVPPHSLSDTLRYRTDNADLGAMLAHFRLLEPVFDALPDVAFFVKDANGRYALVN
RTLALRCGYKDKRDLLGKTTDEVFPRRFGRSYFEQDMATINAGQQLTDQLELHLYPGRQP
GWCLTCKEPLRDASGKVVGLAGISRDLKAHEGSHPAYSKLADVVQHIQDHYVQPLNLKQL
AQMAGMSVAQLERYFHKVFHLTPRQVLLKTRLDAATALLVTHDKVTDVAALCGYTDHSAF
TRQFKATVGVTPTEYRMMLQDRAGERSARGGAPEAAAQR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccacgcttgccgtaccgcctcacagcctgtccgatacgttgcggtatcggacc
gacaacgccgatctcggcgcgatgctcgcgcactttcgcctgctcgagccggtgttcgac
gcgctgcccgatgtcgctttcttcgtgaaggacgccaacggccgctacgcgctcgtcaat
cgcacgctggcgctgcgctgcggctacaaggacaagcgcgacctgctcggcaagacgacc
gacgaagtctttccgcgccgtttcgggcgcagctatttcgagcaggacatggcgacgatc
aacgcgggccagcagttgaccgatcagctcgagttgcatctgtatccggggcgtcagccc
ggctggtgcctgacctgcaaggagccgctgcgcgatgcgtcgggcaaggtcgtcggcctc
gccggcatttcgcgcgacctgaaagcgcacgaaggttcgcatccggcctacagcaagctc
gcggacgtcgtccagcacatccaggatcactacgtgcagccgctgaacctgaagcagctc
gcgcagatggcggggatgtcggtcgcgcagctcgagcgctatttccacaaggtgtttcac
ctgacgccgcgtcaggtgctgttgaagacgcgcctcgatgcggccacggcgctgctggtc
acgcacgacaaggtgaccgacgtcgcggcgttatgcgggtatacggatcacagcgcgttt
acgcgccagttcaaggcgaccgtcggcgtgacgccgacggagtaccggatgatgctgcag
gatcgggcaggggaacgcagcgcgcgcggcggcgcgccggaggcggcggctcagcggtag

DBGET integrated database retrieval system