KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3419Help
Entry
Bmul_3419         CDS       T00624                                 

Definition
(GenBank) 3-dehydroquinate dehydratase, type II
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01130  Biosynthesis of antibiotics
bmu01230  Biosynthesis of amino acids
Module
bmu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bmul_3419
Enzymes [BR:bmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     Bmul_3419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_II Phage_Coat_A
Motif
Other DBs
NCBI-ProteinID: ABX17103
UniProt: A0A0H3KPF5
Position
2:311544..311999
Genome map
AA seq 151 aa AA seqDB search
MSKHKVLVLNGPNLNLLGTREPHIYGAETLADVEQRCRAEAESLGIDLDFRQSNAEHELI
DWLHAARHDTHGIVINPAAYTHTSVALADALSAIAKPVIEVHISNVHRREAFRHHSYVAA
LAEAVICGCGTDGYIFALQRMATLLARGAAR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcacaaggtcctggtgctgaacgggccgaacctcaatctgctgggcacccgc
gagccccatatctacggcgccgaaacgctggccgacgtcgagcagcgctgccgcgccgag
gccgagtcgctcgggatcgatctcgacttccgtcagtcgaacgccgaacacgagctgatc
gactggctgcatgcggcgcgccacgacacgcacgggatcgtgatcaacccggccgcctat
acgcacacgtcggtcgcgctggccgatgcgctgtccgcgatcgcgaagcccgtgatcgaa
gtgcatatttcgaacgtgcaccgccgcgaggcattccgccaccattcgtacgtggccgcg
ctcgccgaagccgtgatctgcggctgcggcaccgacggctacatcttcgcgctgcagcgt
atggcgacgcttcttgcgcggggagccgcgcgatga

DBGET integrated database retrieval system