KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3420Help
Entry
Bmul_3420         CDS       T00624                                 

Definition
(GenBank) Shikimate dehydrogenase substrate binding domain protein
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01130  Biosynthesis of antibiotics
bmu01230  Biosynthesis of amino acids
Module
bmu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bmul_3420
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     Bmul_3420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N SDH_C Sacchrp_dh_NADP AlaDh_PNT_C ThiF
Motif
Other DBs
NCBI-ProteinID: ABX17104
UniProt: A0A0H3KTI4
Position
2:311996..312865
Genome map
AA seq 289 aa AA seqDB search
MNRPSFLIGLIGQGIGGSLSPAMHEEEGFRQGFGYVYRRIDLDALGLSVDALPALLDAAQ
RMGYNGLNITHPCKQRVIEHLDELSDDARALGAVNTVLFRDGRRIGHNTDWSGFAKSFRR
GLPGASLERVVQLGAGGAGAAVAHAALQMGAAELTLFDVDATRAASLAGELQQRFPAARV
VAGGTPSGDALAAAMRAATGLIHATPTGMIKHPGLPLPAELLHAGMWVADIVYFPLETEL
IRAARAAGCATLPGGGMAVYQAVDAFELFTGRTPDAERMFEHFQSLVAR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtccgtcgtttctgatcggcctgatcggccagggcatcggcggatcgctgtcg
cccgcgatgcatgaagaagaaggattccggcagggtttcggctacgtgtaccgacgcatc
gatctcgacgcgctcgggctgagcgtcgacgcactgcccgcgctgctcgatgccgcgcag
cgcatgggatacaacggcctgaacatcacgcatccgtgcaagcagcgcgtgatcgagcac
ctcgacgaactgtccgacgatgcgcgtgcgctcggcgcggtcaacacggtgctgttccgc
gacggccgccggatcggccacaacaccgactggtccggttttgcgaaatcgttccggcgc
gggctgccgggcgcgtcgctcgagcgtgtcgtgcagctcggcgcgggcggcgcgggcgcg
gccgtcgcgcatgcggcgctgcagatgggcgcggccgaactgacgttgttcgacgtcgac
gccacgcgcgccgcgtcgctcgccggcgaactgcagcagcgtttcccggctgcgcgcgtc
gtggcgggcggcacgccctccggcgatgcgctggcggccgcgatgcgcgcggcgaccggc
ctgatccacgcgacgccgaccggcatgatcaagcatcccggcctgccgctgcccgccgaa
ctgctgcacgccggcatgtgggtggccgacatcgtgtatttcccgctcgaaaccgaactg
atccgcgcggcacgcgcggcgggctgcgcgacgctgcccggcggcggcatggccgtctac
caggcggtcgatgcgttcgaactcttcaccggacgcacgcccgacgccgagcggatgttc
gagcactttcagtcgctcgtcgcgcgctga

DBGET integrated database retrieval system