KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3423Help
Entry
Bmul_3423         CDS       T00624                                 

Definition
(GenBank) 2-aminoethylphosphonate ABC transporter, 2-aminoethylphosphonate binding protein
  KO
K11081  2-aminoethylphosphonate transport system substrate-binding protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02010  ABC transporters
Module
bmu_M00302  2-Aminoethylphosphonate transport system
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bmul_3423
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmu02000]
    Bmul_3423
Transporters [BR:bmu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   2-Aminoethylphosphonate transporter [MD:M00302] [OT]
    Bmul_3423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 SBP_bac_1 YidC_periplas
Motif
Other DBs
NCBI-ProteinID: ABX17107
UniProt: A0A0H3KX28
Position
2:315713..316804
Genome map
AA seq 363 aa AA seqDB search
MTLQNSTRAAAGAFRKLALAACAAGLLQGAALPAHAANAVVLYTADGLENLYRDVLPAFE
KKEGVRVNIVTAGSGEVVNRANIEKNSPKADVIVTLPPFIQQAGQMGLLQAYQSVNYKNV
PAIAKAEDGTWATFVNNYFSFAINPEVVKNQPKTFADLLSPSYAGKVAYSNPATAGDGMA
VLILTTSLMGEDKAFDYLAKLSQSVKFHTKGTGYLNVLLSRNEIAVANGDLQMDLDDAEH
GALSVKPIFLAAKEGDQPTTFQLPYGIGLIKGGPNQDAGKKLIDYLMSTDVQSKVPDMYG
IPGRTDVPLTGKNGEAVKKAIAGVKLIPVDWNQVMAKKPVWLERWKKDVIGSSGKPLDVV
KPK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacactgcagaattccacgcgcgccgctgccggcgcgttccgcaagctggcgctggcc
gcgtgcgcggcgggcctgctgcaaggcgcggcgctgcccgcgcatgcggcgaacgcggtc
gtgctgtatacggccgacggcctcgagaacctgtatcgcgacgtgctgcctgcgttcgag
aagaaggaaggcgtgcgcgtgaacatcgtgacggccggcagtggcgaggtcgtgaaccgc
gcgaacatcgagaagaattcgccgaaggcggacgtcatcgtcacgctgccgccgttcatc
cagcaggcgggccagatggggctgctacaggcatatcagagcgtgaactacaagaacgtg
ccggcgatcgcgaaggccgaggacggcacgtgggcgacgttcgtgaacaactacttctcg
ttcgcgatcaacccggaagtcgtgaagaaccagccgaagacgttcgccgatctgctgtcg
ccgagctacgcgggcaaggtcgcgtactcgaacccggcgacggccggcgacgggatggcc
gtgctgatcctgacgacgtcgctgatgggcgaggacaaggcgttcgactatctcgcgaag
ctgtcgcagagcgtgaagttccacacgaagggcacgggctacctgaacgtgctgctgtcg
cgcaacgagatcgcggtcgccaacggcgatctgcagatggatctcgacgacgccgagcac
ggcgcgctgtccgtcaagccgatctttctcgcggcgaaggaaggcgaccagccgacgacg
ttccagctcccgtacggcatcggtctgatcaagggcggcccgaaccaggacgccggcaag
aagctgatcgactatctgatgtcgaccgacgtgcagtcgaaggtgccggacatgtacggc
attccgggccgcaccgacgtgccgctgaccggcaagaacggcgaggcggtgaaaaaggcg
attgcgggcgtgaagctgattccggtcgactggaaccaggtgatggcgaagaagccggta
tggctcgagcgctggaagaaggacgtgatcggcagctcgggcaagccgctcgacgtcgtg
aagccgaagtga

DBGET integrated database retrieval system