KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3907
Entry
Bmul_3907         CDS       T00624                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_3907
Secretion system [BR:bmu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bmul_3907
SSDB
Motif
Pfam: T6SS_VipA Nif11
Other DBs
NCBI-ProteinID: ABX17590
Position
2:874441..874980
AA seq 179 aa
MSASNSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKHPVEPLPAVSER
RFLEIDIDNFDERMKAIRPRVAFAVPNTLTGEGQMMVDMTFESMEDFSPAAIADKVEPLR
RLLQARTQLANLQTYMDGKSGAEALVTQLLQDPALLKSLAAAPRSERHEADAADSANAS
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtccgctagcaattcgcagaagttcatcgcgcgcaatcgtgcgccgcgtgtgcagatc
gagtacgacgtcgaagtgtatggctcggagaagaaagtcgagcttccgttcgtgatgggc
gtacttgccgacctctccggcaagcatccggtcgagccgctgccggcggtgtccgagcgc
cggtttctggaaatcgacatcgacaacttcgacgagcgcatgaaggcgatccggccgcgc
gtcgcgtttgccgtgccgaatacgctgacgggcgaaggccagatgatggtcgacatgacc
ttcgaaagcatggaggacttctcgccggccgcgatcgccgacaaggtcgagccgctgcgc
cgcctgctccaggcgcgtacgcagctggcgaacctgcagacgtacatggacggcaagtcg
ggcgccgaggcgctcgtcacccagctgctgcaggacccggcgctgctgaagtcgctggct
gcggcgccgcggtcggagcggcacgaagcggacgcggccgattccgccaacgcgagctga

DBGET integrated database retrieval system