KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3922Help
Entry
Bmul_3922         CDS       T00624                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bmul_3922
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_3922
Secretion system [BR:bmu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bmul_3922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C AvrRpt-cleavage
Motif
Other DBs
NCBI-ProteinID: ABX17605
UniProt: A0A0H3KMG7
Position
2:891119..895219
Genome map
AA seq 1366 aa AA seqDB search
MKKFPFLPFLASRQFLAFLALIVVALVIWFVGPFFTFGGLKPFADAGMRALLIALLLAGV
LLWLVGWSISIVLAALFCLLIWYAGPLLALGRTVPLESASARLGAIAVVAAVFVVVGMFR
IWQKMREDAAFMKKMLRLDRKKADPLAASRLEKVEGGVTSALARLKSMRTGARGLGKLFQ
GKRYLYELPWYITLGSQGSGKTSILMNGGLAFPVAEQMQRAAAKPAADAAAVDWWLTNDA
VLIDTTGYYTRHGMSTADAAGTRVAEQQDKPAPDVSDKDTANAQANSERSADGTQQGAPA
KSEATAGSKSSVDVVPRAADRRELPQQIDRAEWFGFLGLLRRHRPRAPINGALLTVDLAT
LASADEQARVAEAAALRARLAELREELGVRFPVYLTITKMDRLAGFAEYFGTLTSEGRAQ
VWGFTLPYGKETVAKEGLRARCHHELAQLAQRLTGSIDTHLQDEYDLNKRRKLAALPEAF
SALLEPLLDLIDHVFLDSRYDNTQLHSTLRGVYFTSARQQGSEIVAERHTVVQRLLSTEK
PAAVAPSRAEGNQGFFLHDLLTRVVFPEAHLVSPNLRWEYRYRLVRLIGHTLALLLFVWL
AIGLRVSYGNNSDYLDAMGRKAQALAGRVAALYKTPELQAVPDTLTEARNLPTFSGLDLS
DPDSAWRYGLYTPTDIATESRRTYDVLEDNLLLPQILHRLEDVMSGAIANKDSKAAYDAL
RVYLMLYDKAKFNAGDVKAWVLDDWAKNDSAAAFGGRASMIEHVQQLFSGERVVQSSLIR
NDALVRQTRAFLDGSNATDRLYQRAKAAMLMEAPDEFTLLRAVGPQAGTVFTRASDAPLS
RGVSGLFTFDGYRNLFDKRLREFVQLARDDDAWVMGRSYLGEAQKKTAEIVNGAAGADDA
LTDAVRREYLTEYAQQWAAFLDDIRTVSGTSLAFNLKVLRSFAAPDSPLARLARAAVRET
TLTQQPVASNGSLLQKAADQLNQKADKALGIRASERVERELVDNRFAALREVVTGSADAL
SDAHSAGTQADKTGLDGVVNLLNDYYTALTVADNALSNNSMPPASDTAAKLKMAADTMPA
PFRAILLKLAADGSREVNHGIGQLLSRQMQAVVGDTCRLTIEGNYPFSPDSQRDVGIDDF
TRVFAQGGVIDDFFVKTLAPFVDTSAKPWRYRTLPGATEPVQGPSLEPFEHAKAIRDIFF
NDPDHKQMTWKADIRVPELAPTIMSLSLDIDGQTTLYQHGPVAPFTIAWPGPRGGAHAEI
AAGPRIRPDTSTISADGPWALMRLLQKGKVIATATPGRTRVAFGFDGREAVLDIASAGSV
ANPLTSDVLKTFRCPTSMATFSLPDSGPPPGLPQGMLPMNAGSVSR
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtttccgttcctgccgtttctggcctcgcgccagttcctcgcgttcctcgca
ctgatcgtcgttgcactggtgatctggttcgtcggtccgttcttcacatttggcgggctc
aagccattcgcggatgccggcatgcgtgcgctgctgatcgcgttgctgctcgccggtgtg
ctgctctggctggtcggatggtcgatcagcatcgtgttggcggcattgttttgcttgctg
atctggtacgcgggcccgttgcttgcgttgggtcgcacggtaccgctggaatcggcgtcg
gcacgtcttggcgcgatcgcggtggtggcagccgttttcgtcgtcgtcggcatgttccgt
atttggcaaaaaatgcgcgaagacgccgcgttcatgaagaagatgctgcgtctggatcgc
aagaaggcggacccgcttgcagcttcacgtcttgagaaagtcgaaggcggcgtgacgagc
gcgctcgcgcgcctgaaatcgatgcgtaccggcgcacgcggcctcggcaagctgttccag
ggcaagcgctatttgtacgagctgccctggtacatcacgctcggctcgcaaggatccggc
aagacgagcatcctgatgaacggcgggctggcatttcccgttgccgagcagatgcagcgc
gcggccgcgaaaccggctgccgatgccgccgccgtggactggtggctgacgaatgacgca
gtgctgatcgacacgaccggctactacacgcgtcatggcatgtcgacggccgatgccgcc
ggtacacgagtcgcagaacaacaggacaagccggcacctgacgtgtccgacaaggatacc
gccaacgcgcaggcgaactcggaacgttccgccgatggcacgcaacagggcgcgcctgcg
aaatcggaggcgacggccggctcgaagtcgagtgtcgatgtcgtaccgcgtgctgccgac
aggcgcgagcttccgcagcagatcgatcgcgcggaatggttcggctttctcggcctattg
cgtcgacaccggcctcgtgcgccgatcaacggcgcattgctgacggtcgatcttgcgacg
ctggcaagcgcggatgaacaggcgcgcgtcgccgaggctgccgcattgcgcgcaaggctc
gccgaactgagagaggaactgggcgttcgcttccccgtttacctgacgatcacgaagatg
gaccgcctcgcgggctttgccgagtatttcgggacgctcacgtccgaggggcgggcgcag
gtctggggtttcacgcttccatacggcaaggaaacggttgcgaaggaagggctgcgtgcg
cgttgtcaccacgaactcgcgcaactcgcgcaacggttgacgggctcgatcgatacgcat
ctgcaggacgaatacgacctgaacaagcgtcgaaagcttgccgcgttgcctgaggcgttt
tcggcactgctcgaaccgctgctcgacttgatcgaccacgtattcctcgattcccgctac
gacaatacgcagctccattcgacgttgcgcggcgtgtatttcacgagtgcccggcaacag
ggcagcgagatcgtggcggaacgccatacggtcgttcaacgtcttctgtcgactgagaag
ccggccgcggtcgcaccgtcgcgcgcggaggggaaccagggattcttcctgcacgatttg
ctgacccgtgtcgtgttccccgaggcgcatctcgtgagccccaacctgcgttgggaatat
cgctacaggctggtgcgcctgatcggccacacgctggcgctgctgctgttcgtctggctg
gcgatcggtttgcgcgtgagctatggcaacaacagcgattatctcgacgcgatgggccgc
aaggcgcaggcgcttgccggccgcgtcgcggcgctgtacaagacgcccgaactgcaagcc
gtgcccgacacgttgaccgaggcgcgcaatctgcccacgttttcggggctcgacctgtcc
gatccggacagtgcatggcgctacggtctgtacacgccgacggacattgccaccgaaagt
cgccgcacttacgacgtactcgaagacaacctgctgctgccgcagatcctgcatcgtctg
gaagacgtcatgtccggtgcgattgcgaacaaggattcaaaggccgcgtacgacgcgctt
cgcgtatacctgatgctgtacgacaaggcgaagttcaatgccggcgacgtcaaggcatgg
gtactcgacgactgggcgaagaacgacagcgccgccgctttcggcggcagggcgtcgatg
atcgagcacgtgcaacagctcttctcaggggagcgtgtcgtgcagtcttcgctgatccgc
aacgacgcgctggtacggcagacgcgcgcgttccttgacggcagcaatgcgaccgatcgt
ctgtaccagcgcgcgaaggccgcgatgctcatggaagcacccgacgagttcacgttgctg
cgcgcggtcggcccgcaggccggaacggtgttcacgcgagcgagcgacgcgccgttgtcg
cgcggcgtgtcgggtctcttcacgttcgacggctatcggaatctgttcgacaagcgactg
cgcgagttcgtgcaactcgcgcgcgacgacgacgcttgggtgatggggcgctcgtatctc
ggcgaggctcaaaaaaaaacggctgagatcgtcaatggcgcggccggtgcggacgacgcg
ttgaccgacgccgtccgccgcgaatacctgacggagtatgcgcaacagtgggcggcgttt
ctcgacgacatccggaccgtgagcggcacgagtctcgcattcaatctgaaagtgctgcgc
agcttcgcggcgcccgattcgccgcttgcgcgtcttgcccgtgccgcagtgcgcgagacg
acgctcacacagcaaccggttgcgtcgaacggctcgctgttgcaaaaggcggccgaccaa
ttgaaccagaaagccgacaaggcgcttggcattcgagcctcggagcgtgtcgagagggaa
ctcgtcgacaatcgtttcgcggccttgcgtgaggtcgtgacgggaagcgccgatgcactg
tccgacgcccactcggccggtacccaggcggacaagacgggactcgacggcgtcgtcaac
ctgctgaacgactactacacggcgctgaccgtcgccgataacgcgctgtcgaacaacagc
atgccgccggcgagcgacacggccgcgaagctcaagatggccgccgacacgatgcctgcg
ccgttccgcgcgatattgctcaagctcgcggccgacgggtcgcgcgaggtcaatcacggg
atcggccaactgttgtcgcgccagatgcaggcggtggtcggcgatacctgccgattgacg
atcgaaggaaactatccgttctctccggacagccagcgcgacgtcgggatcgacgacttc
acgcgcgtgttcgcgcagggcggcgtgatcgacgatttcttcgtgaagacgctggcgccg
tttgtcgatacgtccgcgaaaccgtggcgctatcgaacgctgccgggcgcgacggaaccc
gtgcaggggccgagcctcgagccgttcgagcatgcgaaggcgattcgcgacatcttcttc
aacgatccggaccacaagcagatgacgtggaaggccgacatccgcgttccggaactcgcg
ccgacgatcatgagcctgtcgctcgacatcgacgggcagacgacgctttaccagcacggt
ccggtcgcgcccttcacgattgcgtggccggggccgcgcggcggcgcgcacgccgagatc
gcggccggcccgcggatccggccggacacctcgacgatttccgccgatgggccttgggcg
ttgatgaggctgctgcagaaaggcaaggtgatcgcgacggccacgccgggccgcacgcgt
gtcgcattcggtttcgacggtcgcgaagcggtgctcgacatcgcgagcgccggcagtgtc
gcgaatccgttgacgagcgatgtgttgaagacgttccggtgccccacctcgatggcgacg
ttcagtttgccggacagcggtccgccgccgggattgccacagggcatgttgccgatgaac
gccggaagcgtttcccgttga

DBGET integrated database retrieval system