KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4132Help
Entry
Bmul_4132         CDS       T00624                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bmul_4132
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bmul_4132
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bmul_4132
    1.1.1.-  
     Bmul_4132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABX17813
Position
2:complement(1140333..1141427)
Genome map
AA seq 364 aa AA seqDB search
MSTAASSSARSMKAAVWRGRRDIRVEEVPVPERPPAGWVKIRVHWCGICGSDLHEYVAGP
VFIPVDAPHPLTGLKGQCILGHEFSGEIAELGDGVTGFAIGDRVTADACQHCGTCWYCTH
GLYNICENLAFTGLMNNGAFAEYVNVPAELLYRLPDGFPTEAGALIEPLAVGLHAVKKAG
SIVGQTVVVVGAGTIGLCTIMCAKAAGAGRVIALEMSDARKAKALEVGASVVIDPKTSDA
IAEVKALTGGYGADVSFECIGHTTTAKLAIDVIRKAGKSVMVGIFEEPAPFNFFDIVSTE
KEVIGSLAYNGEFADVIRFIADGRIDVQPLITGRIALGDIVARGFEELVHHKDRNVKIIV
QPAT
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagccgcatcgagttccgcccgcagcatgaaggccgccgtgtggcgcggccgc
cgcgacatccgcgtcgaagaggttcccgtaccggagcggccgccggccggctgggtgaag
atccgcgtgcactggtgcggcatctgcggctcggacctgcacgaatacgtcgccggcccc
gtattcattccggtcgacgcgccgcatccgctgacgggcctgaaaggccagtgcatcctc
ggtcacgagttcagcggcgagatcgccgagctcggcgacggcgtgacgggcttcgcgatc
ggcgaccgcgtgacggccgacgcctgccagcattgcggtacctgctggtactgcacgcac
gggctctacaacatctgcgaaaacctcgcgttcaccggcttgatgaacaacggcgcgttc
gcggagtacgtcaacgtgccggccgaactgctgtaccggctgcccgacggcttcccgacc
gaagccggcgcgctgatcgagccgctcgcggtcgggctgcacgcggtgaagaaggccggc
agcatcgtcgggcagaccgtcgtcgtggtcggcgcgggcacgatcgggctgtgcacgatc
atgtgcgcgaaggccgccggcgcgggccgcgtgatcgcgctcgagatgtccgacgcgcgc
aaggcgaaggcgctcgaagtcggcgcgagcgtcgtcatcgatccgaagacgtcggacgcg
atcgccgaggtgaaggcgctgacgggcgggtacggcgccgacgtgtcgttcgaatgcatc
ggccacacgacgacggcgaagctcgcgatcgacgtgatccgcaaggccggcaagtcggtg
atggtcgggatcttcgaagagccggcgccgttcaacttcttcgacatcgtgtcgaccgag
aaggaagtgatcggctcgctggcgtacaacggcgagttcgcggacgtgatccgcttcatc
gcggacggccggatcgacgtgcagccgctgatcaccggccgcatcgcgctcggcgacatc
gtcgcgcgcggcttcgaggagctcgtccatcacaaggaccgcaacgtgaagatcatcgtg
cagccggcgacctag

DBGET integrated database retrieval system