KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4205Help
Entry
Bmul_4205         CDS       T00624                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00010  Glycolysis / Gluconeogenesis
bmu00052  Galactose metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_4205
   00052 Galactose metabolism
    Bmul_4205
Enzymes [BR:bmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bmul_4205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABX17886
UniProt: A0A0H3KM76
Position
2:complement(1236048..1237136)
Genome map
AA seq 362 aa AA seqDB search
MTFDTDSSRTASDVARTPSEPWGPLPGGDPVRRYTLRNAHGMRVVVSDLGATVVSWLAPD
RTGRFADIVLAHDTPADYLASGAYLGATVGRWANRIAGARFTLDGIDYPLDRNENGNLLH
GGASGFHRERWDVIDDRGGLTLRLDSPEGDAGFPGNVSVQVRYTLDDDGTLTIDYTGTSD
APTPLNLTNHSYFNLSGRAGSDVRGHVLRIDADAFLEVDDALIPTGRADVTGTAFDFRQS
APLGARLDWPHAQLARGRGFDHCYVLRDDVHGVRPVASIYDPESGRELTVSTDQCGLQLY
TGNYLDGLRVSGGTTCVRHAALCVEAGCFPNQINMAELADATIVRPGDTYRQTTRYRVAV
RA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgataccgattcttcccgcaccgcgtccgacgtcgcccgcactccgtccgag
ccgtggggtccgctgcccggcggcgatccggtgcggcgctatacgctgcgcaacgcgcac
gggatgcgcgtcgtcgtcagcgacctcggcgcgaccgtggtgtcgtggctcgcgcccgac
cgcaccggccgcttcgccgacatcgtgctcgcgcacgacacgccggccgactatctcgcg
tccggcgcgtatctcggcgcgacggtcggccgctgggcgaaccggatcgccggcgcgcgc
ttcacgctcgacggcatcgactatccgctcgatcgcaacgagaacggcaatctgctgcac
ggcggcgcaagcggctttcatcgcgaacgctgggacgtgatcgacgatcgcggcggcctc
acgctgcggctcgattcgcccgaaggcgacgcggggtttcccggcaacgtcagcgtacaa
gtgcgctatacgctcgacgacgacggcacgctgacgatcgactacacgggcacgagcgat
gcaccgacgccgctgaacctgacgaatcacagctacttcaatctgagcggccgcgcgggc
agcgacgtgcgcggccacgtgctgaggatcgatgcggacgcgtttctcgaagtcgacgac
gcgctgattccgaccggccgcgccgacgtgacgggcaccgcgttcgatttccggcaaagc
gcgccgctcggtgcgcgcctcgattggccgcacgcgcagctcgcgcgtggccgcggcttc
gatcactgctacgtgctgcgcgacgacgtgcacggcgtgcggccggtcgcgagcatctac
gatccggaaagcggccgcgagctgaccgtgtcgaccgatcaatgcgggctgcagctctat
accggcaactatctcgacggcctgcgcgtcagcggcggcacgacctgcgtgcggcatgcg
gcgctgtgcgtcgaggccggctgctttccgaatcagatcaacatggcggagctcgctgat
gccacgatcgtacggcccggcgatacgtatcggcagacgacgcgctatcgcgtcgccgtg
cgcgcgtaa

DBGET integrated database retrieval system