KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4466Help
Entry
Bmul_4466         CDS       T00624                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00020  Citrate cycle (TCA cycle)
bmu00620  Pyruvate metabolism
bmu00650  Butanoate metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
Module
bmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bmul_4466
   00620 Pyruvate metabolism
    Bmul_4466
   00650 Butanoate metabolism
    Bmul_4466
Enzymes [BR:bmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Bmul_4466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABX18145
UniProt: A0A0H3KUH0
Position
2:complement(1541318..1542832)
Genome map
AA seq 504 aa AA seqDB search
MTSSRILAPALRSLVRTADQAAALIRPGMTVAMSGFTGSGYPKAVPAALAAHIEAAHARG
EDFRINVLTGASTAPELDGALARTNGISMRLPYQSDPTLRDKINGGEVDYQDIHLSHVAQ
YAWFGLFGELDVAIVEVAGIREDGLLIPSASVGNNKTWLEQAKHVILEVNARQPLGLDGM
HDIYYGTALPPNRKPIPLTKSDDRIGEPYLRCPAEKIVAIVETDAPDRSNAFSAPDDTSK
QIATRLIDFLRHEVKRGRLPANLLPLQSGVGNITNAVLAELSSAGFSDLTAYTEVIQDGM
LDLLADGTLRFASATALSLSPPAVQRFADQIAMFREKILLRPQEISNHPELVRRLGCIAM
NGMIEADIYGNVNSTHVMGTKIQNGIGGSGDFARNGYLSCFMSASTAKGGAISRIVPMAS
HVDHTEHDVAVVVTEQGLADLRGLSPKQRARKIIATCAHPDYRPMLEDYFERASHESFGK
HTPHLLAEALSWHERFVRTGTMKV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatcacgcatcctcgctcccgcgctgcgttcgctcgtccgcactgccgaccag
gccgccgcgctgatccgtcccggcatgaccgtcgcgatgagcggcttcaccggctcgggc
tacccgaaggccgtgccggccgcgctcgccgcccatatcgaggccgcccatgcgcgcggc
gaagacttccggatcaacgtgctgacgggcgcctcgaccgcacccgaactcgacggcgcg
ctcgcgcgcacgaacggcatctcgatgcggctgccgtaccagtccgacccgacgctacgc
gacaagatcaacggcggcgaagtcgactatcaggacattcacctgagccacgtcgcgcag
tacgcatggttcggactgttcggcgagctggatgtcgcgatcgtcgaagtcgccggcatc
cgcgaggacgggctgctgattccgtcggcgtcggtcggcaacaacaagacgtggctcgag
caggcgaagcacgtgattctcgaggtcaacgcacgtcagccgctcggcctcgacgggatg
cacgacatctattacggcaccgcattgccgccgaaccgcaagccgatcccgctgacgaaa
agcgacgaccgcatcggcgagccgtatctgcgctgcccggccgagaagatcgtcgcgatc
gtcgagaccgacgcgccggaccgcagcaacgcgttctccgcgccggacgacacgtcgaag
cagatcgcgacgcgcctgatcgacttcctgcgccacgaagtgaagcgcggccggctgccc
gcgaatctgctgccgttgcagtcgggcgtcggcaacatcacgaacgcggtgctcgccgaa
ctgagctcggccggcttttccgatctgaccgcgtacacggaagtgatccaggacggcatg
ctcgacctgctcgccgacggcacgctgcgtttcgcatcggcgaccgcgctgtcgctgagc
ccgcccgccgtgcagcgcttcgccgaccagatcgcgatgttccgcgagaagatcctgctg
cgcccgcaggagatcagcaaccatccggagctcgtgcgccggctcggctgcatcgcgatg
aacggcatgatcgaggccgacatctacggcaacgtgaactcgacgcacgtgatgggcacg
aagatccagaacggcattggcggctcgggcgacttcgcgcgcaacggctatctgtcgtgc
ttcatgtcggcgagcaccgcgaagggcggcgcgatttcgcggatcgtgccgatggcaagc
catgtcgaccataccgagcacgacgtcgcggtggtcgtcaccgagcaggggctcgccgac
ctgcgtgggctctcgccgaagcagcgcgcacgcaagatcatcgcgacctgcgcgcatccg
gattaccggccgatgctcgaggactatttcgagcgcgcgtcgcacgagagcttcggcaag
cacacgccgcatctgctcgccgaagcgctgtcgtggcacgagcgcttcgtgcgtaccggc
acgatgaaggtctga

DBGET integrated database retrieval system