KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4647Help
Entry
Bmul_4647         CDS       T00624                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00020  Citrate cycle (TCA cycle)
bmu00190  Oxidative phosphorylation
bmu00650  Butanoate metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
Module
bmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bmul_4647
   00650 Butanoate metabolism
    Bmul_4647
  Energy metabolism
   00190 Oxidative phosphorylation
    Bmul_4647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABX18325
UniProt: A0A0H3KQM5
Position
2:complement(1752843..1753211)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFS
AQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacaaccgaatcggctcgaagcgcctcgtcgtcggcgcgcactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgttcttcggcgcgcacgacttctcctacgaaggctgggcgtcgatcttctcc
gcacaatggatgaagctcgcgaccttcgtgacgctgctttccctcttctatcacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system