KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5304Help
Entry
Bmul_5304         CDS       T00624                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bmul_5304
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bmul_5304
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bmul_5304
    1.1.1.-  
     Bmul_5304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc Methyltransf_25 Methyltransf_12 TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABX18974
UniProt: A0A0H3KIR6
Position
2:2454237..2455358
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGPRDVRLVDIDTPRVGPGEVRIAVAYCGICGSDLHEYADGPHAIPVDAPHPLS
GRTAPLTLGHEFCGTVVEVGAGVTTLRAGDRVAVEPEYRCQRCAYCRAGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPEGVTLEQAAVLEPAAVALHALRRGELRLGNTCAVFGL
GPIGLLLIMLAKLQGATTIVAVDVSPQRLAAAKRFGATRAFDARSLDAAALRDAIRAETG
GLGVDVAFEAAGLPATFEAAMHALRKGGRVVMVGLMPHAGFDAFRAVNDELTFTASVGYR
HAYDDLLRIVASGVLDPASIVTRTVALEHAIADGFDALLADRTQIKVLVSPALGASRRTY
ASGSIEHEPSADV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttcaatggcatggcccgcgcgacgtccgtctcgtcgacatcgacacgccg
cgcgtcgggccgggcgaggtacgcatcgccgtcgcgtattgcggcatctgcggcagcgat
ctgcacgaatacgcggacggcccgcacgcgattccggtcgacgcaccgcatccgctgtcc
gggcgcaccgcaccgctgacgctcggtcacgagttctgcggcaccgtcgtcgaagtcggc
gcgggcgtgacgacgttgcgcgccggcgaccgtgtcgcggtcgagcccgagtatcgctgc
cagcgctgcgcgtactgccgggccggctcgtacaacctctgcgtatcgatgggctttgcc
gggctcatgggcgacggcggaatggccgacttcgcggtcgtgccggcctatatgctgcat
cgcctgcccgagggcgtcacgctcgaacaggcggcagtgctcgagcccgccgccgtcgcg
ctgcatgcactgcggcgcggcgagctgcggctcggcaatacctgcgcggtgttcggcctc
ggaccgatcggactgctgctgatcatgctcgcgaagctgcaaggggcgaccacgatcgtc
gccgtcgacgtgtcgccgcagcgcctcgcggccgcgaagcgcttcggcgcgacgcgcgcg
ttcgacgcccgctcgctcgatgcggccgcgctgcgcgacgcgattcgcgcggaaaccggc
ggcctcggcgtcgacgtcgcgttcgaggcggccgggctgcccgcgacgttcgaagccgcg
atgcacgccttgcgcaaaggcggacgcgtcgtgatggtcggcctgatgccgcacgcgggc
ttcgatgcgtttcgcgccgtcaacgacgagctgaccttcacggcgagcgtcggctaccgg
cacgcgtacgacgatctgctgcgcatcgtcgcgtccggcgtactcgatccggcgtcgatc
gtcacgcgcaccgtcgcgcttgagcacgcgatcgccgacggcttcgacgcgctgctcgcc
gaccgcacgcagatcaaggttctcgtttcaccggcgctcggcgcgagccgccgcacctat
gcctcggggagcatcgaacatgagccaagcgcagacgtttga

DBGET integrated database retrieval system