KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5546
Entry
Bmul_5546         CDS       T00624                                 
Name
(GenBank) Conjugal transfer protein TrbG/VirB9/CagX
  KO
K20532  type IV secretion system protein TrbG
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bmul_5546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_5546
Secretion system [BR:bmu02044]
 Type IV secretion system
  Trb secretion system protein
   Bmul_5546
SSDB
Motif
Pfam: CagX Na_H_antiporter
Other DBs
NCBI-ProteinID: ABX19216
Position
3:260975..261850
AA seq 291 aa
MKRTRSLLGWGALAVIAASANAFAAKSAANPIAPVPNFDVGSIIGDAMSPVNPYNSGADP
ITMPGDARMAVFTYSRDKIFRVMTAPLKLTTIELERGETLVSEPAMGDSVQWVLDTDGAN
HVYVKPTKPGLVNTLHLSTNRREYELTLVSSPLGGLFYQNVRFSYANSLMAKVRARGNAT
GEEHDTDQGAPSDSGPIGVSPDKLNFEYTVSGTNSLKPETVFDDGTFIWIRMPPRTPFAV
PTIKDGGDVVSPNFIRRGPYIVIQRLADEVKLTRPGEEVTITRGRRGLFGF
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaaacgaacacgttccctcctgggctggggcgcgctggcggtgatcgcggcatcggcc
aatgcgttcgcagccaaatctgcagcgaacccgattgcccccgtcccgaatttcgatgtc
ggcagcatcatcggcgatgcgatgagcccggtgaatccctacaactctggcgcggatccg
atcacgatgccgggcgatgcacgcatggcagtgttcacgtatagccgcgacaagatcttt
cgggtgatgactgcgccgctgaagctcacgacaattgagctcgagcgcggcgagaccttg
gtcagcgagccagcgatgggcgactccgtgcagtgggttctcgatacggacggcgcaaat
cacgtctacgtgaagcccactaagccgggcctcgtcaacacgctgcacctgagcacaaac
cggcgcgagtacgagctgacgctcgtttcctccccgttgggtggcctgttttatcagaac
gtgcgcttcagctacgcgaactcgctgatggcgaaggtgcgggcacgcggcaacgcaacg
ggggaagaacacgatactgaccaaggcgccccatccgattccggtcctatcggcgtatcg
cctgacaagctgaacttcgagtacaccgtctcggggacgaactcactcaaacccgagacg
gtcttcgacgacggcacgttcatctggatccggatgccgcctcgcacgccgtttgccgtg
cccaccatcaaggatggcggtgacgtcgtcagcccgaactttatccgccgcggtccatac
attgtcattcagcgactggccgatgaggtcaagctcacgcgacccggcgaggaagtgacg
atcacgcgcggccggcgcggcctgttcgggttctga

DBGET integrated database retrieval system