KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5548
Entry
Bmul_5548         CDS       T00624                                 
Name
(GenBank) Lytic transglycosylase catalytic
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB
Motif
Pfam: SLT SLT_3
Other DBs
NCBI-ProteinID: ABX19218
Position
3:263129..263935
AA seq 268 aa
MIARAAFALAFALAASYAQSAVIAQVISPVSVVIQDGQSRRVAMLPGKPVYYCGLDAFIE
WASPLVGQPVRSSRETGITVSIDGRDVALDDLFIDRGWLQPPVLDDGAQAALVERRGGWA
CSRAVVPFELLHTNVDPKILAGIALNESNYRGRAWPWTLNVAGQGYFFKSREEAYKAIES
LLARDRCDFDVGLMQVNWCYHGKRFRSAWDALAPATNVAVAEAILTENFARTDSVAKAVA
YYHSANPNPGRAYLARFVQHLSMIEAGL
NT seq 807 nt   +upstreamnt  +downstreamnt
atgatcgcgcgcgcggcttttgccctcgcattcgcgctggcggcctcatacgcgcagtcg
gccgtgatcgcgcaggtgatcagcccggtaagcgtcgtcattcaagacggacagtcacgt
cgggtcgcgatgctacccggcaagccggtctattactgcggcctcgacgctttcatcgaa
tgggcgtcgccgctagtcggacaacctgttcgcagctcccgtgagacgggcatcacggtg
tcgatcgatgggcgcgacgtcgcactggacgatctgttcatcgaccgtggctggctacaa
ccgccggtgctggatgacggtgcgcaggcggcgcttgtcgagcgccgcggcggatgggcg
tgctcgcgtgctgtcgtaccgttcgagttgctgcacaccaacgtcgatccaaagattctc
gccgggatcgcgctgaacgaatcgaattaccgcggccgtgcatggccttggacgctcaac
gtcgctgggcagggctacttcttcaagtctcgcgaagaggcgtacaaggcgatcgagtct
ttgctcgcgcgcgatcgctgcgatttcgacgtcgggctgatgcaggtgaactggtgctac
cacggcaagcgttttaggtccgcatgggacgcgctcgcgcccgcgacaaatgtcgcggtc
gccgaggcgatcctcaccgagaatttcgcgcgcactgactcggttgcgaaggctgtcgcg
tactaccacagcgcgaaccccaatcccgggcgcgcatacctcgcacggttcgtccaacac
ctttccatgatcgaggcaggcctgtga

DBGET integrated database retrieval system