KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5606
Entry
Bmul_5606         CDS       T00624                                 
Name
(GenBank) type II secretion system protein E
  KO
K02283  pilus assembly protein CpaF [EC:7.4.2.8]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_5606
   02035 Bacterial motility proteins [BR:bmu02035]
    Bmul_5606
Enzymes [BR:bmu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Bmul_5606
Secretion system [BR:bmu02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Bmul_5606
Bacterial motility proteins [BR:bmu02035]
 Pilus system
  Pilus assembly proteins
   Bmul_5606
SSDB
Motif
Pfam: T2SSE FtsK_SpoIIIE AAA_29 AAA_7 Dynamin_N AAA_28 ABC_tran IIGP DO-GTPase1 AAA_16
Other DBs
NCBI-ProteinID: ABX19276
Position
3:314829..315875
AA seq 348 aa
MSEIAENPFLKVARLEENAVQLFFESLKLIKPYLDSPNVAEVMINSANNIWVEERGVMRR
LEIEFNPATLTGAIHSLAASVEKSAHAGTAQGIINGGHKNLRIATVMKPTAIDGDALAIR
RHRETNLSIKDYARMGAFSLVHAKRSIERPIFPPGVADEALAEAFTTMVQQRANVLVAGG
TSTGKTTFLNALNGLIPSEERVITIEDTMELKVDLPNRVRLLSNPDKGVTTQVLVALCLR
FRPDRIIVGEVRGGEAFDFIQALSTGHDGGMGSIHSNDARGGLSRLESLAMLGIPRGSRW
ELTDMRKAIADCFHYVIHLRRSGELRHVSEVLAIKGFKDGDYVLERVF
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtctgaaattgccgaaaatccctttctgaaggtcgcgcgactcgaagagaacgcggta
cagctgttcttcgagtcgctgaagctcatcaagccgtacctcgattcaccaaatgtcgcc
gaagtcatgatcaactcggcgaacaacatctgggtcgaggagcggggggtgatgcgccgc
ctcgaaatcgaattcaatccggcgacgctgacaggtgccattcattcgctcgcggcctcg
gttgagaaatccgcgcacgctggtacggcccaggggattatcaacggcggccacaagaat
ctgcggatcgcaaccgtcatgaagccgacggcaatcgacggagatgcgctcgcgatccgg
cggcaccgcgagaccaatctttcgatcaaggattacgcgcgcatgggcgccttctccttg
gtccacgcgaagcgaagcattgagcggcctatcttcccacccggcgtcgcggatgaagcg
ctcgccgaggcgttcaccacgatggttcagcagcgcgccaatgtgctcgtcgccggcggt
acatcgaccggcaagactacgttcctcaacgcgctgaatggtctgattcccagtgaggag
cgggtcatcacgatcgaagacacgatggagctgaaggtcgaccttccgaaccgggtccga
cttctgtcgaaccccgacaagggcgtgacaacgcaggttctggtggcgctttgccttcgg
ttccgtcccgacagaatcatcgtcggcgaagtccgcggcggagaagcgttcgacttcatc
caggcgctcagcaccggccatgacggcggaatgggttcgattcactcgaatgatgcgcgc
ggcggcctgagccgcctcgagagcctcgcgatgttgggcatcccgcgcggcagccggtgg
gagctcaccgacatgcgcaaggcaatcgccgactgtttccactacgtcattcacctgcgc
cgatcaggggagctgcgccatgtgtcggaagtactggcgatcaagggcttcaaagacggg
gactacgttctcgaacgcgttttttaa

DBGET integrated database retrieval system