KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5608
Entry
Bmul_5608         CDS       T00624                                 
Name
(GenBank) conserved hypothetical protein
  KO
K20529  type IV secretion system protein TrbD
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bmul_5608
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_5608
Secretion system [BR:bmu02044]
 Type IV secretion system
  Trb secretion system protein
   Bmul_5608
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ABX19278
Position
3:316315..316578
AA seq 87 aa
MGGADRGLAIANGTLTTLLCYTSMSPTFLVVGIVVHWVLRWLSSSDPWWREVLVVYNRYP
DVHEPLATADVAARFRRPYGFDQELPL
NT seq 264 nt   +upstreamnt  +downstreamnt
atggggggcgcggaccgcggtctcgcgatcgccaacggaaccctgaccacattgctttgc
tacaccagcatgtcgccgaccttcctcgtcgtgggaatcgtcgtccattgggtgcttcgt
tggctgtcgtcgagcgatccgtggtggcgcgaggtgctggtcgtctacaaccggtacccc
gacgttcacgagccacttgcgacagcggatgttgccgcccgattccggcggccgtatgga
tttgatcaggagcttccgttgtga

DBGET integrated database retrieval system