KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5609
Entry
Bmul_5609         CDS       T00624                                 
Name
(GenBank) type IV secretory pathway VirB4 components-like protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bmul_5609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_5609
Enzymes [BR:bmu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Bmul_5609
Secretion system [BR:bmu02044]
 Type IV secretion system
  Trb secretion system protein
   Bmul_5609
SSDB
Motif
Pfam: CagE_TrbE_VirB TraG-D_C AAA_10 AAA_22 TrwB_AAD_bind ABC_tran
Other DBs
NCBI-ProteinID: ABX19279
Position
3:316575..319052
AA seq 825 aa
MSANPKRRAVQEIAPWATMVTPEIILDKDGSLLTLYSFEGVDADSPNSDEISAARDNLDH
ACKNFDHRITAWWRVSHRRVRGEIGGKFASEMDRHVDAINQKSIGSGKYFRNTHSLALAY
TPETGINKLFEKVAYHMTVGGKSVPIALLETVKDMVLARSAFVFDMERITSDIKRFEGIL
DAFKGGVARLKMKRLQLQSALAFLHQTANPSVPPRRVRYPVTMLDTHLTETFVTYGAEHI
MFESAYGTRYAKIISVKEWMGFQEAALDVLTDVDAELDVCVMFRFLSTSKAQAFIEKMRK
FYKVAAFSPMKILKGFFSKDEKKENMENEKGREILAEEAENALARLIADGQQYGFVNISV
VVYGDTVTECDDNAREIVGRIGNAGFGVLVEKRNLPAAWASTLPGRWDQQKRLQFVETPV
VSDIAPVRGVAEGSDVNPWLTQQLGERIGPLTLLPTRHRTLQRVSLHDPSGKSHALIVGP
IGAGKTIFLNFLVSQTGRFRPRRIKFDKNRSTRIPTVFANGKFVDVTGKFAAATQVNPLS
LLADPRHYTYVSGWVQMAIEGDGEDFRCTPQQERTIYERVVTLAQGYGPEYWTLSFLAPL
LPAELRDRLQIWTKGEKNGRFFDHVEDAFSLSDDLAIEMGELFESYPVAAALFMDYAFYR
ISQWLDGKRVTIIEVEECGFFFRYPRFYARLEMWVVTIRGLNGTLVMATQSLSQLERVPN
FEIMKENIPNFFFLPNRDARNNKRLYRDVFGLTDDQIDMISDGVPNRDYLWVTPDHSRML
QAKFPKEALAILRADGAAQRTLDKHLASGSPTWREDYLAEMATLD
NT seq 2478 nt   +upstreamnt  +downstreamnt
gtgagcgccaacccgaagcgtcgagcggttcaggaaatcgccccgtgggcgacgatggtg
acgcccgaaattattctggacaaggacgggtcattgctgaccctgtactcgttcgagggc
gtggacgccgacagccccaattccgacgaaatctcggccgcccgagacaatctcgaccat
gcttgcaaaaatttcgaccaccggatcaccgcctggtggcgcgtatcgcaccgccgagta
aggggagaaatcggcggcaagttcgcgtcggaaatggatcggcacgtcgatgcgatcaac
cagaagagtatcgggagcggaaagtacttccgcaatactcactctctcgcgctcgcatat
acgcctgaaaccggcatcaacaagctcttcgaaaaagtcgcgtaccacatgacggtgggc
ggaaaatcggtcccgatcgcgttgctcgagaccgtcaaagatatggtccttgcgcgtagt
gcgttcgtgttcgacatggaacgcatcacgtcggatatcaagcgcttcgaaggcatcctg
gacgcgttcaaaggcggcgtagcgcgcctcaaaatgaagcggctccagctgcagagcgcc
ttggcgttccttcaccagaccgccaatccgtcggttcccccgcggcgcgtgcggtatccc
gtgacgatgctcgacacccatctgaccgaaaccttcgtgacgtacggcgccgagcacatc
atgttcgagtccgcctatgggacacggtacgcaaagatcatctcggtgaaagagtggatg
ggcttccaggaggccgcacttgacgtcctgactgacgtcgacgcggagctagacgtgtgc
gtcatgtttcgcttcctctcgaccagcaaggcacaggcgttcatcgagaagatgcgcaag
ttctataaggtcgctgcgttcagtccaatgaagatcctgaaggggttcttctcgaaggac
gagaagaaggaaaacatggagaacgagaaggggcgcgagatcctggcagaggaggccgaa
aacgcgctcgctcgcctgatcgctgatggccagcagtatggcttcgtgaacatctcggta
gtcgtatatggagacacggtcaccgagtgtgacgacaacgcgcgggagattgtcggccgc
atcggcaacgctggattcggtgtactggtcgagaagcgcaacttgccggcagcgtgggca
tcgacgctccccgggcgctgggatcaacaaaagcgcctgcagttcgtcgagacgccagta
gtctcggacatcgcgccggtgcgcggcgttgcggaaggcagcgacgttaatccatggctc
acgcagcagcttggcgagagaatcggccctttgacgcttctcccgacccggcaccgaacg
ctgcagcgggtctcgttgcacgatccgagtggaaagtcgcacgcgctgatcgtcggtccg
atcggtgccggcaagacgatctttctcaactttctcgtttcccaaactggacgcttccgg
ccgcgccgcatcaagttcgacaagaaccgttcaacgcgcattccgaccgtgtttgccaat
ggcaagttcgtcgacgtcaccggcaagtttgcagctgcgacgcaggtcaacccgctgtct
ctgttggccgatcctcggcactacacctacgtgtcggggtgggtgcagatggcaatcgag
ggcgacggtgaggatttccggtgcaccccgcaacaggagcggacgatctacgaacgcgtt
gtcacgctcgcgcagggctatggtcccgagtactggacgctctctttcctggccccgcta
ctgcctgccgagctacgggaccgcttgcagatctggacgaaaggtgaaaagaacggtcgg
ttcttcgaccacgtcgaggacgcgttctcgctgtctgacgatctggcaatcgagatgggg
gaattgttcgaaagctacccggtcgctgcggcgctgtttatggactacgcgttctatcgg
atctcgcagtggctcgacggcaagcgcgtcacgatcattgaggttgaggagtgcgggttc
ttcttccggtatccgcgcttctatgcacggctggagatgtgggtcgtgacgatccggggt
ttgaacgggacgctagtgatggcgactcagtcgctgagccagctagaacgggttccgaac
ttcgagatcatgaaggagaacatcccgaacttcttcttcctcccgaaccgggacgctcgg
aacaacaaacgcctctatcgcgatgtgtttggcctgacggacgaccagatcgacatgatc
agcgatggcgttcccaaccgcgactatctgtgggttacgccggatcactcccggatgctg
caggcgaaattcccgaaggaagcactcgcgatattgcgcgccgatggcgcggcgcagcgg
actctcgacaagcacctcgccagcggctcgccgacttggcgcgaagactatctcgctgaa
atggcgactctcgactga

DBGET integrated database retrieval system