KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5962Help
Entry
Bmul_5962         CDS       T00624                                 

Definition
(GenBank) ABC transporter related
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bmul_5962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmu02000]
    Bmul_5962
Enzymes [BR:bmu01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     Bmul_5962
Transporters [BR:bmu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Bmul_5962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_30 Zeta_toxin RsgA_GTPase AAA_29 AAA_25 SMC_N MMR_HSR1 SbcCD_C AAA_23 Dynamin_N FeoB_N
Motif
Other DBs
NCBI-ProteinID: ABX19620
UniProt: A0A0H3KQ85
Position
3:complement(689744..691255)
Genome map
AA seq 503 aa AA seqDB search
MTNPPVVEMIDIDKTFPGVNALQRVSFRLFPGEIHALMGQNGAGKSTLINVLTGVHAHDA
GEIRVGGTPVRFAAPREAEAAGIQTLYQEVNLCANLSVAENIFAGRQPMRRGAIDWKTIH
ARARDALAELDLSLDVTRSLDAYPIAVQQMVAIARAVSVDARVLILDEPTSSLDDGEVAR
LFDVLRRLKASGIAILFVTHFLEQTYAISDRITVMRNGEREGEYLARDLPVDALVAKMTG
RERLSDTLQARAAEAARGGASAPFLSMQQVGRRGMISALDLDVRPGEIVGLAGLLGSGRT
ETAQLAFAAERADTGAIEIDGARARLASPHDAVRHGIAYCPEDRKKEGIVAALSIRENIV
LALQARRGWWRLIGRARQRELADAYIERLGIKARDAEQPIGLLSGGNQQKVLLARWLATD
PKLLILDEPTRGIDVAAKFDIMERVLGLCAKGLAILFISSEISEVVRVSHRIAVLRDRRK
VAEVSGADASEEQIYRLIAGGQS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatccgccggtcgtcgagatgatcgacatcgacaagacgtttccgggcgtcaac
gcgctgcagcgcgtgagtttccggctgtttccgggcgaaatccatgcgctgatgggccag
aacggcgcaggcaaatcgacgctgatcaacgtgctgactggcgtgcatgcgcacgatgcg
ggcgaaattcgcgtcggcggcacaccggtgcgcttcgccgcgccgcgcgaggccgaagcg
gccggcatccagacgctgtaccaggaagtgaacctgtgcgcgaacctgtcggtcgcggag
aacatcttcgcgggccggcagccgatgcggcgcggcgcgatcgactggaagacgatccat
gcacgcgcgcgcgatgcgctcgccgaactcgacctgtcgctcgacgtcacgcgctcgctc
gacgcgtatccgatcgccgtgcagcagatggtcgcgatcgcgcgggcggtgtcggtcgac
gcgcgcgtgctgattctcgacgagccgacctcgagcctcgacgacggcgaggtcgcgcgg
ctgttcgacgtgctgcgccgactgaaggcgtcgggcatcgcgatcctgttcgtcacgcat
tttctcgaacagacgtatgcgatctccgaccgcatcaccgtgatgcgcaacggcgagcgc
gaaggcgagtatctcgcgcgcgatctgccggtcgatgcgctcgtcgcgaagatgacgggc
cgcgaacgattgtccgatacgttgcaggcgcgcgcggccgaggcggcgcgcggcggcgcg
agcgcgccgttcctgtcgatgcagcaggtcggccggcgcggcatgatcagcgcgctcgat
ctcgacgtgcggcccggcgagatcgtcgggctggccggattgctcggctcggggcgcacc
gaaaccgcgcagctcgcgtttgccgccgagcgcgcggatacgggcgcgatcgagatcgac
ggcgcgcgcgcgcggctcgcgtcgccgcacgatgcggtgcggcacggcatcgcgtattgc
ccggaggaccgcaagaaggaagggatcgtcgccgcgctgtcgatccgcgagaacatcgtg
ctcgcgctgcaggcacggcgcggctggtggcggctgatcggccgcgcgcgccagcgcgaa
ctcgccgacgcgtatatcgagcggctcggcatcaaggcgcgcgacgcggaacagccgatc
gggctgctgtcgggcggcaaccagcagaaggtgctgctcgcacgctggctcgcgaccgat
ccgaagctgctgatcctcgacgagccgacgcgcggcatcgacgtcgccgcgaagttcgac
atcatggaacgggtgctcggcctgtgcgcgaaggggctcgcgatcctgttcatctcgtcg
gagatcagcgaggtcgtgcgcgtgagccatcggatcgcggtgctgcgcgatcggcgcaag
gtggcggaagtgtcgggcgccgacgcatccgaggaacagatctatcgattgatcgccgga
ggccagtcatga

DBGET integrated database retrieval system