KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_6203Help
Entry
Bmul_6203         CDS       T00624                                 

Definition
(GenBank) Type IV secretory pathway VirD4 protein-like protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf AAA_10
Motif
Other DBs
NCBI-ProteinID: ABX19856
UniProt: A0A0H3KRN8
Position
pBMUL01:50998..53025
Genome map
AA seq 675 aa AA seqDB search
MTEKVISDAGAGRALFMTRVKLTVHAASMAFFVGALPAMVLPSVWWMNTLTAHDVDLVKA
NILSHVVDQEVPRRWRIRDGVGEKKILTVVKSDGELAQWLTPPQFRNVVPDLARPVTAFR
YVAWVSVGLGAAGYYAVWRSLARLGRRARENKRVDGALDVVSAEELSKAVRREEAGPYTV
LDVALPRSAPMQGIMFVGAQGTGKSLGIHDLMGQVFARGRKSVIYDHAGEYFRAYYRPGK
DLFFNPALLGSVPWSMFMEMENTYDSDTLAHAFLPPKAGVVHGASAFFEDAARVLFSVMA
LRLRQRGAVYTRLISEAILSMPEDELELLIKNSVASSAVGGDSKGQRQGVISSIAIYLNG
IAAVQDGTWTLREFYEKDDDTRLFLIGTEDTYAMFAPLFRLLITMAFQTIAARREIRHED
RYWFFLDETHVLGDIKLDARQAELRKYGVCVAAGIQADKQFNTSMGADRAETLMNCFNTT
VTLRLNEPNMQERMARRLGKSETAVVRAGQAIAVTDWRDGGQLSQDEREKWVVMPSKIGL
LKNCMAYVQVAGDFPPALVNYRHWLPRWYRPWPRTLRFRERQPDPPRDPRFKISAADGQD
AIESVRAEAEAMKAQAAAAAAAAATSPTAAVTTQGKWIVTDLDTGEVMLPTADVGRGDEH
SDGREPVSQENEGLF
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaaggtaatctccgatgccggcgcgggacgcgcgcttttcatgactcgggtc
aagctgactgtccatgctgcctcgatggcattttttgtcggggcgttgccggcgatggtt
ctgccgagcgtctggtggatgaacacgcttactgctcatgatgtcgacctcgttaaggcc
aatatcttgtcccacgtcgtcgatcaggaggtaccgcgacgctggcggattcgcgatggt
gttggggagaaaaagatcctcaccgtcgtcaaatccgacggcgagctcgcccagtggtta
actccccctcagtttaggaacgttgtacccgaccttgctcggccagtcacggcattccga
tatgtcgcgtgggtcagcgtcggacttggtgcggccggctattacgcggtttggcggtcc
cttgcgcggctcggtcggcgggctcgtgagaacaagcgcgtcgacggagcgttggacgtc
gtctcggctgaagagctgtcgaaagctgtacgccgcgaggaggcggggccgtataccgtc
cttgacgtggcccttcctcgatctgcgccgatgcagggcattatgtttgtcggggcgcaa
ggaacaggcaaatcgttgggtattcacgatcttatgggccaggtgttcgcgcgcggccga
aagtcggtaatttacgatcatgccggcgaatactttcgagcgtactaccgtcccggaaaa
gacctgttctttaatcccgccctgcttggctcggtcccttggtcgatgttcatggagatg
gagaacacctacgattcggacacgcttgcacacgcattcttgccgcctaaggcgggggtc
gtgcatggtgcgagcgcattctttgaggacgcagcgcgagtgctattttcggtgatggcc
ttacgcttgcgtcaacgcggggcggtctatacccgcctgatttccgaggccatcctttcc
atgccggaggacgagcttgagctcttgatcaagaattctgttgcgagctcggcagtcggc
ggcgactccaaggggcagcgtcaaggggtgatcagttcaatcgccatctacttgaacgga
atcgccgcggttcaggacggcacttggacgctccgcgagttctacgaaaaggacgacgac
acgcgacttttcctcatcggcaccgaggacacgtatgcgatgttcgcaccgctatttcgc
ctcttgatcacgatggcatttcagacgattgccgcgcgccgggaaattcgtcacgaggac
cgctattggttttttcttgatgaaacgcatgtccttggtgacatcaagctggacgcccgg
caagcggagttgcggaagtacggggtttgcgtcgccgctggcattcaagcagacaagcag
ttcaatacgtccatgggtgcggaccgcgccgaaacgctaatgaactgcttcaacaccact
gttacgctccgtctcaatgaaccgaacatgcaggagcgaatggcgcggcgcttggggaag
agtgagacagccgtagtcagggcgggacaggcgatcgccgtgaccgattggcgtgacggg
gggcagcttagccaggacgagcgcgaaaagtgggtggtcatgccatcgaagattgggttg
ctgaaaaactgcatggcatacgttcaggttgccggtgactttccgccggcattggtgaac
taccgccactggctacctcgatggtatcgaccgtggccacgaaccttgcgattccgcgag
aggcagccggacccgccacgcgatccgcggttcaagatatccgccgcggatggtcaagat
gcgatagaaagcgtccgggccgaggcggaagcaatgaaggcccaagctgctgcagcggca
gcggcagcggcaaccagtccgacggcggccgtaacgacgcagggaaagtggatcgtcacc
gatctagacactggcgaagtgatgcttccgacagccgacgtcgggcgtggcgatgaacat
agcgacggtcgagagccggtctcgcaagaaaatgaggggttgttctga

DBGET integrated database retrieval system