KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_6204
Entry
Bmul_6204         CDS       T00624                                 

Definition
(GenBank) conjugative relaxase domain protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB
Motif
Pfam: TrwC AAA_30 AAA_19
Other DBs
NCBI-ProteinID: ABX19857
Position
pBMUL01:53708..56971
AA seq 1087 aa
MPHPDTGKIQNLANNSKGDKRRAGIDFTIAPPKSVSIAALVGKDDRVIAAHLAANARTME
WFEKHASLIRVKDEKGRNRPEVAGNLLYATVLHETNRENEPQLHNHNVIVSAVYDGARHS
WRSLTNDLLYTLRARGDIIYKAELAAALRHLGYQLVYAENGIDFELKGFSRDHVDTFSTR
AVQVREALLKHGIDPGEASFDARRVAKLDSRAAKQEHPREILQSVWEETAKEANLDVASI
VERAREAFADRQVPRRGVERTVEHGAAMGQDSGPSRGAAVSVSNDARANALRAVSWAIEH
LTEREQAFTLVDLEVTALKFSRGSISEIEWAIDQHVRNHMLVDRGITVGGQIQYTTHKAI
DNELKLAEHILAGRGQGNVVLDAEDQFDAAVAAFEAKKTAEIGEQFKLSGEQIQAARNVL
MHEDSIQGIQGEAGTGKTAALAMVKDVAQAMGWEVIGVATSAAAAKELEASSGIQSDTVA
GYFAKRDSAIRAVELRLQDLRKSISERATLRGLDDQRIEARTLAVKSEDIDYGTHRYTFD
HQRGEVFRSPENLRNAIGAALSEIAARHREAAGTEQGHPVTLGEQARETVRAAAANVAAS
LGRRLMTFEQIGTAEAVAARNTLYLERQGSATELDAEYARTQAKLENLRRYGNVDGKKTL
IVMDESSLTGVDDTEKLLRFAREIGARTVLQGDVKQHGSVAAGRAFEQAQIAGMNVSILE
ETRRFRDATAQTRQALADMKAGNYAQAIARLDTLRVAESDLAKTVAERYLENLQELTAKG
VDAPKVGVVAITNSDRKLINAAVHQALTDVGIISGPHFEKPHLDDPKMTGAEQRYASMLS
RNRVDALIYRKSYREIGVEKGDVLTVTGYDVQKNRIYALNAKGKSVEINPQRQDYFSPAI
QESRVFAVGDRVETRAIIRLPGQELNRLDNGTQGVIVAIDSLGAKIRWYRDGKESDLKND
DLRFVDHAYAHTSYKEQGATNHREIVAVSKIGARVFNREAAYVAASRAKDNTEIITSDLD
TLLRNAGREVGKTTAVEFERAESSLDQSADQGAKHGATRSIEVAPTRSVETERTLERSPD
PGNLLGF
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgccgcatccggacactggcaagatccagaatctggcgaacaacagtaagggggacaag
cgccgggcgggtatcgacttcacgattgcgccgccgaaaagcgtgtcgatcgcggcattg
gttgggaaggacgaccgtgtgatcgcggcgcaccttgcagcgaatgcgcggacgatggaa
tggtttgagaagcatgcttctctgattcgcgtgaaagacgaaaagggaagaaaccggccg
gaagtggccggcaacttgctgtatgcgacggtgctgcacgaaactaaccgggagaacgag
ccgcagcttcataaccacaacgtgatcgtatccgctgtttacgatggggcacgccattcg
tggcgcagccttaccaacgacctgttgtacacgctacgggcgcgcggcgacatcatttac
aaagcggagctcgcggctgccctgcgacatcttggttaccaacttgtgtatgcggagaac
ggcatcgatttcgagctgaagggcttttcacgcgatcacgtcgacacattcagtacccgc
gcggtccaggtccgcgaggcgcttttgaagcatggcatagatccgggcgaagctagcttt
gatgcacgcagggtagccaaactcgacagccgagcagccaagcaggagcacccccgggag
attctgcagtcggtgtgggaggagacggcgaaagaagcaaatttggacgtggcctcgatc
gtagaacgcgcgcgggaggcgttcgctgatcggcaagttccgcgacgcggtgtagagcga
acggtggagcacggggcggcgatggggcaggattccgggccaagtcggggcgcagcagtt
agcgtttcgaacgatgctcgagcgaacgctctgcgggcagtctcctgggcgatcgaacat
ttgaccgaacgggagcaggctttcacactcgttgatctcgaggtcacggcgttgaagttc
agtcgcggcagcatttctgagatcgagtgggcgatcgatcagcatgtgcgtaaccatatg
ctggtcgatcgcggcatcacggtgggcggccagatccaatacacgacccacaaggcgatc
gataacgagcttaagcttgcggagcacattctcgccggccgaggtcagggaaacgttgtg
ctcgatgcggaagaccaattcgacgccgcggtcgcggcattcgaagcgaagaagacagcc
gaaattggagagcagtttaagctctccggggaacagatacaggcggctcgcaatgtcctg
atgcatgaagattcgattcagggcattcagggcgaggccgggacaggcaagacggcggcg
ttagcgatggtgaaggacgtcgctcaagcgatggggtgggaggtaattggcgtggcgacc
tccgcagcggccgcgaaggagctcgaggcttcgagcggcatccaaagcgataccgttgca
gggtatttcgcgaaacgagacagtgccatccgggcggtcgagcttcggcttcaagaccta
cggaagtcgatctcggaacgggcgacgctccggggcctcgacgatcagcgaatcgaggct
cggacgttggcggtaaagagcgaagatattgactacggcacccacaggtacacgtttgat
catcagcggggtgaagtcttccggtcgccggagaaccttcgcaatgcgatcggggcagcg
ttatcggaaatcgcggcgcgtcacagagaagcggccggaactgaacagggacaccctgta
acgctcggcgaacaggctagggagacggtgcgtgctgcagcggctaacgttgcggcgtcc
ctcggccgtcgactcatgacattcgaacagatcggaacagcagaggctgtcgcggcgcgg
aacacgctttaccttgagcggcaagggtccgcaacggaactcgatgcggaatacgctcgg
acgcaggcaaagctcgaaaaccttcggcggtacgggaacgttgacggaaagaagactctg
atcgtgatggatgaatcgtccttgaccggcgtggacgacacggagaaactcctacgattc
gcgcgcgaaatcggcgcgcggaccgtcctgcaaggcgacgtgaagcagcacggcagtgtt
gcagccggtcgggcgttcgaacaagcgcagatcgcagggatgaacgtgtcaattctcgag
gagacgcggcgttttcgggacgctaccgcgcaaacacgccaagccctcgcggacatgaag
gcggggaactacgcacaggcgatcgcgcgtctcgacaccctgcgtgtagcggaatcagac
cttgcaaaaactgtagcggagaggtacctggagaacctccaggaattgacggcaaagggt
gtcgatgcgccgaaggtcggtgtggtcgcgatcaccaacagcgaccggaaattgataaac
gccgctgttcatcaggctttgaccgatgtagggatcatcagcggcccgcacttcgaaaag
ccacaccttgacgacccgaagatgaccggcgccgagcaacgctacgcatcaatgctgtct
cgaaatcgggtagatgcgctcatctatcgaaagagctaccgcgaaatcggcgttgaaaaa
ggcgacgtgctcacagtgactgggtatgacgtccagaagaaccggatctatgcgctgaat
gccaaaggaaagtcggtggagattaaccctcaacgccaagactacttttccccggcgatt
caagagtcgcgcgttttcgccgtaggtgaccgagtcgaaaccagggcgatcatacgcctt
ccaggtcaggagttgaatcggctagacaatggcacgcaaggcgttattgtcgcgatcgac
agccttggtgccaagattcgatggtatcgagatggaaaggagtcggacctaaagaacgac
gacctgcggtttgtggatcatgcgtacgctcacacgtcgtacaaggagcaaggggccacg
aaccaccgggaaattgtggcggtcagcaagatcggtgcgcgcgtgttcaatcgtgaggcc
gcgtatgttgctgcgtcgcgagcgaaagacaacaccgagatcatcacctcggatttggat
acgctacttcgcaacgccggtagggaagtgggcaagacaacagcagtcgagtttgaacgg
gctgagtcttcccttgatcagagtgctgaccaaggggcgaagcacggtgctactcggagt
attgaggtagcaccgactcgttcggtggaaaccgagcgaaccttggagcgttcacccgac
cctggaaacttgttaggcttttaa

DBGET integrated database retrieval system