KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_6226
Entry
Bmul_6226         CDS       T00624                                 

Definition
(GenBank) hypothetical protein
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_6226
Secretion system [BR:bmu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bmul_6226
SSDB
Motif
Pfam: TraV
Other DBs
NCBI-ProteinID: ABX19879
Position
pBMUL01:complement(89914..90603)
AA seq 229 aa
MMILPAIAVSLAACSSAFNPIGSNTYDCNRKQDPTSIYCHSFRAVEASTNGRLPDSRFDT
ELKFSEYDKATDIAPPNRRDLTAPPLLTAGGQPVQLGSGGAASQPAPADATPLHAEMPVR
MGPVIQRTWIKRFVDENDMWTSDLTVLKEIAPSRWTGFDGGNPARAAGGVYPHKVADTPQ
DPSAGAVASAQSAPPAAAPPTTNDFIQPGGPAPGGENPAGIPMPMSMPQ
NT seq 690 nt   +upstreamnt  +downstreamnt
atgatgattttgccggccatcgctgtttcgctcgccgcttgctcgtccgcattcaatccg
atcgggagcaatacgtacgactgcaatcgaaagcaggatccgacgagcatctattgccat
agtttccgcgcggttgaagcttcgaccaatggtcgactgcctgatagccgcttcgatacc
gagctgaaatttagcgagtacgacaaggcaactgacatcgccccgccgaatcgtcgcgac
ttgaccgctcccccgctactgactgccggcggacaaccggtccagcttggctcgggtgga
gcggcgtcccagcctgcgccggccgatgcgacgcctctgcacgcagagatgcccgtccgt
atgggtccggtaatccagcggacctggatcaagcgtttcgtcgacgagaacgacatgtgg
acgagcgacctcaccgtgctcaaggaaatcgcgccatctcgatggacaggattcgacggt
ggcaaccccgcacgggcggccggtggcgtctatccgcacaaggttgccgacacgcctcaa
gacccgtctgctggcgcggtcgcctcggcgcaaagcgcgcctccggctgctgccccgccg
acgaccaacgatttcatccaacccggcggacccgcgccgggcggtgaaaaccccgctggc
atcccgatgccaatgtcaatgccacagtaa

DBGET integrated database retrieval system