KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_6228Help
Entry
Bmul_6228         CDS       T00624                                 

Definition
(GenBank) hypothetical protein
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_6228
Secretion system [BR:bmu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bmul_6228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraK
Motif
Other DBs
NCBI-ProteinID: ABX19881
Position
pBMUL01:complement(91988..92980)
Genome map
AA seq 330 aa AA seqDB search
MDQSSTEEVKPMKTRYLSALMAVYFGSTLSTVAFAQGASASVDFGVATPPAIESAATTTT
TTKTKPKLHGHVKRTRDPLKVDASIAVKNTPQKEIVLPGVLTVPGEGIGVPDPSNVQKVS
WTNTGNKTVYLSADEPNRILLPFKNAYIVHTSDVQVDKREQSNNVYVYWTNAPSQARHLY
IEPPDGGSALGLAIVPKKIPAQTILVTDDTGIVSGRRPKSSPGSEYTSHIQDLMAAIALG
KAPDGFSQVDIQLPPIAMNGLSATVDTRYSSQEGDLYVYTVRNPTQSRAVLREEEFDGPE
VIAVSIYPKPVLLPGEKTRVIVMARKREEQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaagctcaacagaagaagtgaagccgatgaaaacccgctacctttccgccctt
atggcggtctatttcggatcgacactgtccactgttgcgtttgcccaaggcgcatcagcg
tccgtggactttggcgttgctacgccgccggctattgaatccgcggcgacgacgacgacg
acgacgaagacgaagccgaagctccatggccacgtgaaacggacccgtgatcccctgaag
gttgatgcgtcaatcgcagttaagaacacaccgcagaaggaaatcgttcttcctggcgtt
ttgacggtacccggcgagggcattggcgtgcccgacccgtccaatgtccagaaggtctcc
tggaccaacacaggcaacaaaacggtatacctgagcgcagacgagccgaaccggattctg
ctgccgttcaagaatgcgtacattgtccacacgagtgacgttcaagtcgacaagcgtgag
caaagcaataacgtgtacgtctactggacgaacgctccttcgcaagctcgccacctgtat
atcgagccgcccgacggggggtcagcgctcggtctcgctatcgtcccgaagaagatcccc
gcgcaaacaattctcgtgaccgacgataccggcattgtatcggggcgacgccccaagtcg
tcgccaggcagtgagtacacatcccatattcaggacttgatggcggcgatcgctttggga
aaggcgccggatggcttctcacaggttgacatccagttgcctcccatagcaatgaacggc
ctctccgccaccgttgacacccggtacagcagccaagagggcgatctctacgtctatacg
gttcgaaatccaacgcagagcagggccgtgttgcgcgaggaggaattcgacggccctgag
gtcatcgcggtatcgatttacccgaaaccggtacttcttcctggagagaagacccgcgtg
atcgtgatggcgcgtaagcgcgaggagcagtaa

DBGET integrated database retrieval system