KEGG   Burkholderia multivorans ATCC BAA-247: NP80_2093Help
Entry
NP80_2093         CDS       T03881                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00480  Glutathione metabolism
bmul00590  Arachidonic acid metabolism
bmul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    NP80_2093
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NP80_2093
Enzymes [BR:bmul01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NP80_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AJY17747
Position
1:complement(2254283..2254762)
Genome map
AA seq 159 aa AA seqDB search
MSSLYTFSADTLAGVPSTLDVYRGKVLLIVNTASECGFTPQYAGLQKLYERYAARGFFVL
GFPCNQFGKQEPGDAEQIGAFCERNYGVTFPIFAKIDVKGPNAHPLYRYLTDESPGIFGL
KAIKWNFTKFLIDRDGRIVKRYAPSTKPEDIAADIEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccctgtatacattcagcgccgacacgctggccggtgtgccgagcacgctcgat
gtctatcgcggcaaggtgctcctgatcgtcaataccgcgagcgagtgcggtttcacgccg
cagtacgcggggctgcagaagctgtacgaacgctacgcggcgcgcggctttttcgtgctc
ggctttccctgcaaccagttcggcaagcaggagccgggcgacgccgagcagatcggcgcc
ttctgcgagcgcaattacggcgtcacgtttccgatattcgcgaagatcgacgtgaagggt
ccgaacgcgcatccgctgtatcgctatctgaccgacgagtcgcccggcatcttcggcctg
aaggcgatcaagtggaacttcacgaaattcctgatcgaccgcgacgggcgcatcgtgaag
cgctacgcgccttcgacaaagcctgaggacatcgccgcggatatcgaaaagctgctctga

DBGET integrated database retrieval system